Management of obesity: The main treatment for obesity consists of dieting and physical exercise. Diet programs may produce weight loss over the short term, but maintaining this weight loss is frequently difficult and often requires making exercise and a lower calorie diet a permanent part of an individual's lifestyle.Dieter Weichert: Dieter Weichert (born 1948) is a German mechanical engineer specialising in solid mechanics and polymer rheology. Since 1995 he is the Director of the Institute for General Mechanics of RWTH Aachen.Classification of obesity: Obesity is a medical condition in which excess body fat has accumulated to the extent that it has an adverse effect on health.WHO 2000 p.Molar mass distribution: In linear polymers the individual polymer chains rarely have exactly the same degree of polymerization and molar mass, and there is always a distribution around an average value. The molar mass distribution (or molecular weight distribution) in a polymer describes the relationship between the number of moles of each polymer species (Ni) and the molar mass (Mi) of that species.Birth weight: Birth weight is the body weight of a baby at its birth.Definitions from Georgia Department of Public Health.Overweight PoochAnti-obesity medication: Anti-obesity medication or weight loss drugs are all pharmacological agents that reduce or control weight. These drugs alter one of the fundamental processes of the human body, weight regulation, by altering either appetite, or absorption of calories.List of countries by food energy intake: Food consumption refers to the amount of food available for human consumption as estimated by the FAO Food Balance Sheets. However the actual food consumption may be lower than the quantity shown as food availability depending on the magnitude of wastage and losses of food in the household, e.CALERIE: CALERIE (Comprehensive Assessment of Long-term Effects of Reducing Intake of Energy) is a trial currently underway in the U.S.Obesity Treatments and Medical Research: Obesity and its associated diseases are now one of the main causes of morbidity and mortality worldwide. Despite the scale of this problem, successful preventative and treatment options for overweight and obesity remain limited.High-intensity interval training: High-intensity interval training (HIIT), also called high-intensity intermittent exercise (HIIE) or sprint interval training (SIT), is an enhanced form of interval training, an exercise strategy alternating short periods of intense anaerobic exercise with less-intense recovery periods. HIIT is a form of cardiovascular exercise.CachexiaCyclobutaneIndex of energy articles: This is an index of energy articles.TiflorexPRX-07034: PRX-07034 is a selective 5-HT6 receptor antagonist. It has cognition and memory-enhancing properties and potently decreases food intake and body weight in rodents.Adipose tissue macrophages: Adipose tissue macrophages (abbr. ATMs) comprise tissue resident macrophages present in adipose tissue.Mayo Clinic Diet: The Mayo Clinic Diet is a diet created by Mayo Clinic. Prior to this, use of that term was generally connected to fad diets which had no association with Mayo Clinic.Low birth-weight paradox: The low birth-weight paradox is an apparently paradoxical observation relating to the birth weights and mortality rate of children born to tobacco smoking mothers. Low birth-weight children born to smoking mothers have a lower infant mortality rate than the low birth weight children of non-smokers.Temporal analysis of products: Temporal Analysis of Products (TAP), (TAP-2), (TAP-3) is an experimental technique for studyingLeptinSouth Beach Diet: The South Beach Diet is a popular fad diet developed by Arthur Agatston and promoted in a best-selling 2003 book.Sandra Bastin for University of Kentucky Extension Service.Bowel-associated dermatosis–arthritis syndrome: Bowel-associated dermatosis–arthritis syndrome (also known as "Bowel bypass syndrome," "Bowel bypass syndrome without bowel bypass," and "Intestinal bypass arthritis–dermatitis syndrome") is characterized by diarrhea with resultant malabsorption, arthritis and skin lesions, and it is seen in patients who have undergone intestinal bypass surgery, have blind loops of bowel following surgery, had biliopancreatic diversion or have gastrointestinal disorders.Prenatal nutrition: Nutrition and weight management before and during :pregnancy has a profound effect on the development of infants. This is a rather critical time for healthy fetal development as infants rely heavily on maternal stores and nutrient for optimal growth and health outcome later in life.Carbohydrate loading: Carbohydrate loading, commonly referred to as carb-loading or carbo-loading, is a strategy used by endurance athletes, such as marathon runners, to maximize the storage of glycogen (or energy) in the muscles and liver.http://www.Specific appetite: Specific appetite, also known as specific hunger, is a drive to eat foods with specific flavors or other characteristics.Protein toxicity: Protein toxicity with proteinuria can result in those with preexisting kidney disease, or those who have lost kidney function due to age.Outline of diabetes: The following outline is provided as an overview of and topical guide to diabetes:QRISK: QRISK2 (the most recent version of QRISK) is a prediction algorithm for cardiovascular disease (CVD) that uses traditional risk factors (age, systolic blood pressure, smoking status and ratio of total serum cholesterol to high-density lipoprotein cholesterol) together with body mass index, ethnicity, measures of deprivation, family history, chronic kidney disease, rheumatoid arthritis, atrial fibrillation, diabetes mellitus, and antihypertensive treatment.Insulin signal transduction pathway and regulation of blood glucose: The insulin transduction pathway is an important biochemical pathway beginning at the cellular level affecting homeostasis. This pathway is also influenced by fed versus fasting states, stress levels, and a variety of other hormones.Fenfluramine/phentermine: The drug combination fenfluramine/phentermine, usually called fen-phen, was an anti-obesity treatment that utilized two anorectics. Fenfluramine was marketed by American Home Products (later known as Wyeth) as Pondimin, but was shown to cause potentially fatal pulmonary hypertension and heart valve problems, which eventually led to its withdrawal and legal damages of over $13 billion.Animal fatBariatrics: Bariatrics is the branch of medicine that deals with the causes, prevention, and treatment of obesity.Lipid droplet: Lipid droplets, also referred to as lipid bodies, oil bodies or adiposomes, are lipid-rich cellular organelles that regulate the storage and hydrolysis of neutral lipids and are found largely in the adipose tissue.Mobilization and cellular uptake of stored fats and triacylglycerol (with Animation) They also serve as a reservoir for cholesterol and acyl-glycerols for membrane formation and maintenance.Blood glucose monitoring: Blood glucose monitoring is a way of testing the concentration of glucose in the blood (glycemia). Particularly important in the care of diabetes mellitus, a blood glucose test is performed by piercing the skin (typically, on the finger) to draw blood, then applying the blood to a chemically active disposable 'test-strip'.Behavior: Behavior or behaviour (see spelling differences) is the range of actions and [made by individuals, organism]s, [[systems, or artificial entities in conjunction with themselves or their environment, which includes the other systems or organisms around as well as the (inanimate) physical environment. It is the response of the system or organism to various stimuli or inputs, whether [or external], [[conscious or subconscious, overt or covert, and voluntary or involuntary.Wilson–Mikity syndromeLiver sinusoid: A liver sinusoid is a type of sinusoidal blood vessel (with fenestrated, discontinuous endothelium) that serves as a location for the oxygen-rich blood from the hepatic artery and the nutrient-rich blood from the portal vein.SIU SOM Histology GIGross pathology: Gross pathology refers to macroscopic manifestations of disease in organs, tissues, and body cavities. The term is commonly used by anatomical pathologists to refer to diagnostically useful findings made during the gross examination portion of surgical specimen processing or an autopsy.TriglycerideRoux: Roux is flour and fat cooked together and used to thicken sauces. The fat is butter in French cuisine, but may be lard or vegetable oil in other cuisines.Exercise prescription software: Exercise prescription software is a branch of computer software designed to aid in the construction of exercise programmes or regimes for patients who require some kind of ongoing rehabilitation.Regression dilution: Regression dilution, also known as regression attenuation, is the biasing of the regression slope towards zero (or the underestimation of its absolute value), caused by errors in the independent variable.Glucagon-like peptide-2: Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1).K-Mix 2: K-Mix 2 is a high energy food, used for the treatment of severe malnutrition. It was developed by UNICEF in response to the Biafran crisis, and was widely used in later famines in India and Africa.Waist-to-height ratio: A person's waist-to-height ratio (WHtR), also called waist-to-stature ratio (WSR), is defined as their waist circumference divided by their height, both measured in the same units. The WHtR is a measure of the distribution of body fat.Diane Kress: Diane Kress (born February 27, 1959) is a Registered Dietitian and Certified Diabetes Educator. She has spent her career specializing in medical nutrition therapy for overweight/obesity, metabolic syndrome, pre-diabetes, and type 2 diabetes.Lactone: Lactones are cyclic esters of hydroxycarboxylic acids, containing a 1-oxacycloalkan-2-one structure, or analogues having unsaturation or heteroatoms replacing one or more carbon atoms of the ring.Miss Rhode IslandGlucagon-like peptide-1 agonist: Glucagon-like peptide-1 receptor agonists also known as GLP-1 receptor agonists or incretin mimetics are agonists of the GLP-1 receptor. This class of drugs is used for the treatment of type 2 diabetes.Gestational age: Gestational age (or menstrual age) is a measure of the age of a pregnancy where the origin is the woman's last normal menstrual period (LMP), or the corresponding age as estimated by other methods. Such methods include adding 14 days to a known duration since fertilization (as is possible in in vitro fertilization), or by obstetric ultrasonography.