Gastric bypass surgeryRoux: Roux is flour and fat cooked together and used to thicken sauces. The fat is butter in French cuisine, but may be lard or vegetable oil in other cuisines.Vertical banded gastroplasty surgeryManagement of obesity: The main treatment for obesity consists of dieting and physical exercise. Diet programs may produce weight loss over the short term, but maintaining this weight loss is frequently difficult and often requires making exercise and a lower calorie diet a permanent part of an individual's lifestyle.Obesity Treatments and Medical Research: Obesity and its associated diseases are now one of the main causes of morbidity and mortality worldwide. Despite the scale of this problem, successful preventative and treatment options for overweight and obesity remain limited.The Society of Elite Laparoscopic Surgeons: The Society of Elite Laparoscopic Surgeons is a non-profit organization based in Chandler, AZ, existing for the purpose of promoting access to minimally invasive surgery in the United States, and to lobby and promote the transition of the US medical system to adopt minimally invasive hysterectomy as standard of care.Society of Elite Laparoscopic Surgeons The organization is made up of member gynecologic surgeons, and holds annual meetings in various locales.Bowel-associated dermatosis–arthritis syndrome: Bowel-associated dermatosis–arthritis syndrome (also known as "Bowel bypass syndrome," "Bowel bypass syndrome without bowel bypass," and "Intestinal bypass arthritis–dermatitis syndrome") is characterized by diarrhea with resultant malabsorption, arthritis and skin lesions, and it is seen in patients who have undergone intestinal bypass surgery, have blind loops of bowel following surgery, had biliopancreatic diversion or have gastrointestinal disorders.Glucagon-like peptide-2: Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1).Classification of obesity: Obesity is a medical condition in which excess body fat has accumulated to the extent that it has an adverse effect on health.WHO 2000 p.JejunostomySurgical staple: Surgical staples are specialized staples used in surgery in place of sutures to close skin wounds, connect or remove parts of the bowels or lungs. A more recent development, from the 1990s, uses clips instead of staples for some applications; this does not require the staple to penetrate.Chylomicron retention disease: Chylomicron retention disease is a disorder of fat absorption. It is associated with SAR1B.Gastrocolic reflex: The gastrocolic reflex or gastrocolic response is one of a number of physiological reflexes controlling the motility, or peristalsis, of the gastrointestinal tract. It involves an increase in motility of the colon in response to stretch in the stomach and byproducts of digestion in the small intestine.JejunumHyperoxaluriaStomach diseaseGastrostomyScurvy: Scurvy is a disease resulting from a deficiency of vitamin C. Humans and certain animals require vitamin C in their diets for the synthesis of collagen.Gastric inhibitory polypeptide: Gastric inhibitory polypeptide (GIP), also known as the glucose-dependent insulinotropic peptide is a member of the secretin family of hormones.Postperfusion syndrome: Postperfusion syndrome, also known as "pumphead", is a constellation of neurocognitive impairments attributed to cardiopulmonary bypass (CPB) during cardiac surgery. Symptoms of postperfusion syndrome are subtle and include defects associated with attention, concentration, short term memory, fine motor function, and speed of mental and motor responses.Outline of diabetes: The following outline is provided as an overview of and topical guide to diabetes:Internal herniaRevision using distal inflow: Revision Using Distal Inflow (RUDI) is a surgical treatment for Dialysis-associated Steal Syndrome.Omental cake: In radiology, omental cake is sign indicative of an abnormally thickened greater omentum. It refers to infiltration of the omental fat by material of soft-tissue density.Temporal analysis of products: Temporal Analysis of Products (TAP), (TAP-2), (TAP-3) is an experimental technique for studyingBlood glucose monitoring: Blood glucose monitoring is a way of testing the concentration of glucose in the blood (glycemia). Particularly important in the care of diabetes mellitus, a blood glucose test is performed by piercing the skin (typically, on the finger) to draw blood, then applying the blood to a chemically active disposable 'test-strip'.MalabsorptionNesidioblastosisCandy: Candy, also called sweets or lollies, is a confection that features sugar as a principal ingredient. The category, called sugar confectionery, encompasses any sweet confection, including chocolate, chewing gum, and sugar candy.Sensory-specific satiety: Sensory-specific satiety is a sensory hedonic phenomenon that refers to the declining satisfaction generated by the consumption of a certain type of food, and the consequent renewal in appetite resulting from the exposure to a new flavor or food.Raynor H, Epstein L.Partial ileal bypass surgery: Partial ileal bypass surgery is a surgical procedure which involves shortening the ileum to shorten the total small intestinal length.GastrectomyRichter's hernia: A Richter's hernia occurs when the antimesenteric wall of the intestine protrudes through a defect in the abdominal wall. This is discrete from other types of abdominal hernias in that only one intestinal wall protrudes through the defect, such that the lumen of the intestine is incompletely contained in the defect, while the rest remains in the peritoneal cavity.CALERIE: CALERIE (Comprehensive Assessment of Long-term Effects of Reducing Intake of Energy) is a trial currently underway in the U.S.GastroenterostomyCalcium formateGiacomini vein: The Giacomini vein is a communicant vein between the great saphenous vein (GSV) and the small saphenous vein (SSV). It is named after the Italian anatomist Carlo Giacomini (1840-1898).Pleasure Syndrome: 14 October 2011Clara W. Beebe