IsobutyramideCHAP domain: In molecular biology, the CHAP domain is a region between 110 and 140 amino acids that is found in proteins from bacteria, bacteriophages, archaea and eukaryotes of the Trypanosomidae family. The domain is named after the acronym cysteine, histidine-dependent amidohydrolases/peptidases.QNSEnteroglucagon: Enteroglucagon is a peptide hormone derived from preproglucagon. It is a gastrointestinal hormone, secreted from mucosal cells primarily of the colon and terminal ileum.Ethanolamide: Ethanolamides are chemical compounds which are amides formed from carboxylic acids and ethanolamine. Some ethanolamides are naturally occurring, such as anandamide and palmitoylethanolamide, which play physiological roles as lipid neurotransmitters and autocoids.Endocannabinoid reuptake inhibitor: Endocannabinoid reuptake inhibitors (eCBRIs), also called cannabinoid reuptake inhibitors (CBRIs), are drugs which limit the reabsorption of endocannabinoid neurotransmitters by the releasing neuron.Spin–lattice relaxation in the rotating frame: Spin–lattice relaxation in the rotating frame is the mechanism by which Mxy, the transverse component of the magnetization vector, exponentially decays towards its equilibrium value of zero, under the influence of a radio frequency (RF) field in nuclear magnetic resonance (NMR) and magnetic resonance imaging (MRI). It is characterized by the spin–lattice relaxation time constant in the rotating frame, T1ρ.M-Cumenyl methylcarbamateTwo-dimensional infrared spectroscopyDiffuse reflectance infrared fourier transform: Diffuse Reflectance Infrared Fourier Transform Spectroscopy (DRIFTS)C.-P.Hydrogen gas porosity: Hydrogen gas porosity is an aluminium casting defect under the form of a porosity or void in an aluminium casting caused by a high level of hydrogen gas (H2) dissolved in the aluminium at liquid phase. Because the solubility of hydrogen in solid aluminium is much smaller than in liquid aluminium, when the aluminium freezes, the dissolved hydrogen gas creates porosity in solid aluminium.Reaction coordinateDeuterium NMR: Deuterium NMR is NMR spectroscopy of deuterium (2H or D), an isotope of hydrogen. Deuterium is an isotope with spin = 1, unlike hydrogen which is spin = 1/2.Glucagon-like peptide-2: Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1).Database of protein conformational diversity: The Database of protein conformational diversity (PCDB) is a database of diversity of protein tertiary structures within protein domains as determined by X-ray crystallography. Proteins are inherently flexible and this database collects information on this subject for use in molecular research.Ice Ih: [showing details of an ice cube under magnification. Ice Ih is the form of ice commonly seen on Earth.Ethyl groupSharpless asymmetric dihydroxylation: Sharpless asymmetric dihydroxylation (also called the Sharpless bishydroxylation) is the chemical reaction of an alkene with osmium tetroxide in the presence of a chiral quinine ligand to form a vicinal diol.Protein primary structure: The primary structure of a peptide or protein is the linear sequence of its amino acid structural units, and partly comprises its overall biomolecular structure. By convention, the primary structure of a protein is reported starting from the amino-terminal (N) end to the carboxyl-terminal (C) end.SEA Native Peptide LigationTransmembrane domain: Transmembrane segment usually denotes a single transmembrane alpha helix of a transmembrane protein, also known as an integral protein.http://www.Coles PhillipsMonoacylglycerol lipase: Monoacylglycerol lipase, also known as MAG lipase, MAGL, MGL or MGLL is a protein that, in humans, is encoded by the MGLL gene. MAGL is a 33-kDa, membrane-associated member of the serine hydrolase superfamily and contains the classical GXSXG consensus sequence common to most serine hydrolases.Proton emissionIsotopic signature: An isotopic signature (also isotopic fingerprint) is a ratio of non-radiogenic 'stable isotopes', stable radiogenic isotopes, or unstable radioactive isotopes of particular elements in an investigated material. The ratios of isotopes in a sample material are measured by isotope ratio mass spectrometry.SHIFTCORBurst kinetics: Burst kinetics is a form of enzyme kinetics that refers to an initial high velocity of enzymatic turnover when adding enzyme to substrate. This initial period of high velocity product formation is referred to as the "Burst Phase".International Cannabinoid Research Society: The International Cannabinoid Research Society (ICRS) is a professional society for scientific research in all fields of the cannabinoids.ForskolinRGD motifSpecificity constant: In the field of biochemistry, the specificity constant (also called kinetic efficiency or k_{cat}/K_{M}), is a measure of how efficiently an enzyme converts substrates into products. A comparison of specificity constants can also be used as a measure of the preference of an enzyme for different substrates (i.Atomic mass: right |thumb|200px|Stylized [[lithium-7 atom: 3 protons, 4 neutrons, & 3 electrons (total electrons are ~1/4300th of the mass of the nucleus). It has a mass of 7.TaspoglutideAlkaliphile: Alkaliphiles are a class of extremophilic microbes capable of survival in alkaline (pH roughly 8.5-11) environments, growing optimally around a pH of 10.Acid catalysis: In acid catalysis and base catalysis a chemical reaction is catalyzed by an acid or a base. The acid is the proton donor and the base is the proton acceptor.Lanthanide: The lanthanide or lanthanoid series of chemical elementsThe current IUPAC recommendation is that the name lanthanoid be used rather than lanthanide, as the suffix "-ide" is preferred for negative ions, whereas the suffix "-oid" indicates similarity to one of the members of the containing family of elements. However, lanthanide is still favored in most (~90%) scientific articles and is currently adopted on Wikipedia.Glucagon rescueDNA binding site: DNA binding sites are a type of binding site found in DNA where other molecules may bind. DNA binding sites are distinct from other binding sites in that (1) they are part of a DNA sequence (e.Dipeptide: A dipeptide is a sometimes ambiguous designation of two classes of organic compounds: Its molecules contain either two amino acids joined by a single peptide bond or one amino acid with two peptide bonds.Outline of water: The following outline is provided as an overview of and topical guide to water:Yamaguchi esterification: The Yamaguchi esterification is the chemical reaction of an aliphatic carboxylic acid and 2,4,6-trichlorobenzoyl chloride (TCBC, Yamaguchi reagent) to form a mixed anhydride which, upon reaction with an alcohol in the presence of stoichiometric amount of DMAP, produces the desired ester. It was first reported by Masaru Yamaguchi et al.X-ray magnetic circular dichroismCannabinoid receptor antagonist: The discovery of the endogenous cannabinoid system led to the development of CB1 receptor antagonists. The first cannabinoid receptor antagonist, rimonabant, was described in 1994.Standard enthalpy of formation: The standard enthalpy of formation or standard heat of formation of a compound is the change of enthalpy during the formation of 1 mole of the compound from its constituent elements, with all substances in their standard states at 1 atmosphere (1 atm or 101.3 kPa).Phase problem: In physics the phase problem is the name given to the problem of loss of information concerning the phase that can occur when making a physical measurement. The name itself comes from the field of x-ray crystallography, where the phase problem has to be solved for the determination of a structure from diffraction data.Organic base: An organic base is an organic compound which acts as a base. Organic bases are usually, but not always, proton acceptors.Norwegian heavy water sabotage: The Norwegian heavy water sabotage was a series of actions undertaken by Norwegian saboteurs during World War II to prevent the German nuclear energy project from acquiring heavy water (deuterium oxide), which could be used to produce nuclear weapons. In 1934, at Vemork, Norsk Hydro built the first commercial plant capable of producing heavy water as a byproduct of fertilizer production.Chronic solvent-induced encephalopathy: Chronic solvent induced encephalopathy (CSE) is a condition induced by long-term exposure to organic solvents, typically in the workplace, that lead to a wide variety of persisting sensorimotor polyneuropathies and neurobehavioral deficits even after solvent exposure has been removed. This syndrome can also be referred to as "psycho-organic syndrome", "organic solvent syndrome", "chronic painter's syndrome", "occupational solvent encephalopathy", "solvent intoxication", "toxic solvent syndrome", "painters disease", "psycho-organic syndrome", "chronic toxic encephalopathy", and "neurasthenic syndrome".High-performance liquid chromatography: High-performance liquid chromatography (HPLC; formerly referred to as high-pressure liquid chromatography), is a technique in analytical chemistry used to separate, identify, and quantify each component in a mixture. It relies on pumps to pass a pressurized liquid solvent containing the sample mixture through a column filled with a solid adsorbent material.Peptoid: Peptoids, or poly-N-substituted glycines, are a class of peptidomimetics whose side chains are appended to the nitrogen atom of the peptide backbone, rather than to the α-carbons (as they are in amino acids).ImatinibMagainin: Magainin are a class of antimicrobial peptides found in the African clawed frog Xenopus laevis. They were discovered by Dr.Raman microscope: The Raman microscope is a laser-based microscopic device used to perform Raman spectroscopy.Microscopical techniques in the use of the molecular optics laser examiner Raman microprobe, by M.Knotted protein: Knotted proteins are proteins whose backbones entangle themselves in a knot. One can imagine pulling a protein chain from both termini, as though pulling a string from both ends.IlmeniteHigh anion gap metabolic acidosisGlutamineFast atom bombardment: Fast atom bombardment (FAB) is an ionization technique used in mass spectrometry in which a beam of high energy atoms strikes a surface to create ions. It was developed by Michael Barber at the University of Manchester.AsparagineAcylation: In chemistry, acylation (rarely, but more formally: alkanoylation) is the process of adding an acyl group to a compound. The compound providing the acyl group is called the acylating agent.PhosphorylethanolamineEthyl oleateProximity ligation assay: Proximity ligation assay (in situ PLA) is a technology that extends the capabilities of traditional immunoassays to include direct detection of proteins, protein interactions and modifications with high specificity and sensitivity. Protein targets can be readily detected and localized with single molecule resolution and objectively quantified in unmodified cells and tissues.Stilbene photocyclization: Stilbene photocyclization is the coupling of two aromatic carbons in stilbenes upon ultraviolet irradiation. The reaction can be used to form polycyclic aromatic hydrocarbons and heteroaromatics.Permissive temperature: The permissive temperature is the temperature at which a temperature sensitive mutant gene product takes on a normal, functional phenotype.http://www.Phenylpiperidine: Phenylpiperidine is a chemical compound with a phenyl moiety directly attached to piperidine. There are a variety of pharmacological effects associated some phenylpiperidines including morphine-like activity or other central nervous system effects.JWH-047: JWH-047 is a selective cannabinoid ligand, with a bindining affinity of Ki = 0.9 nM for the CB2 subtype, and more than 65 times selectivity over the CB1.JWH-196: JWH-196 is a synthetic cannabinoid receptor ligand from the naphthoylindole family. It is the indole 2-methyl derivative of related compound JWH-175, and the carbonyl reduced analog of JWH-007.Electrospray ionizationSesamolGlycerideList of strains of Escherichia coli: Escherichia coli is a well studied bacterium that was first identified by Theodor Escherich, after whom it was later named.DiflubenzuronBenzopyrone: Benzopyrone may refer to either of two ketone derivatives of benzopyran which constitute the core skeleton of many flavonoid compounds:Lattice protein: Lattice proteins are highly simplified computer models of proteins which are used to investigate protein folding.C4H7N3O3FERM domain: In molecular biology, the FERM domain (F for 4.1 protein, E for ezrin, R for radixin and M for moesin) is a widespread protein module involved in localising proteins to the plasma membrane.Heterocyclic amine: Heterocyclic amines, also sometime referred to as HCAs, are chemical compounds containing at least one heterocyclic ring, which by definition has atoms of at least two different elements, as well as at least one amine (nitrogen-containing) group. Typically it is a nitrogen atom of an amine group that also makes the ring heterocyclic (e.SurinabantTripalmitinThioamide