Glucagon receptor
In humans, the glucagon receptor is encoded by the GCGR gene. Glucagon receptors are mainly expressed in liver and in kidney ... Furthermore, the structural dynamics of an active state complex of the Glucagon receptor, Glucagon, the Receptor activity- ... "Structure-function of the glucagon receptor family of G protein-coupled receptors: the glucagon, GIP, GLP-1, and GLP-2 ... The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family ...
Glucagon receptor family
Glucagon receptor Glucagon-like peptide 1 receptor Glucagon-like peptide 2 receptor Gastric inhibitory polypeptide receptor The ... glucagon, glucagon-like peptide-1, glucagon-like peptide-2) derived from the proglucagon polypeptide. The last receptor binds ... "Structure-function of the glucagon receptor family of G protein-coupled receptors: the glucagon, GIP, GLP-1, and GLP-2 ... The glucagon receptor family is a group of closely related G-protein coupled receptors which include: ...
Glucagon-like peptide receptor
The glucagon-like peptide receptors (GLPRs) include the following two receptors: Glucagon-like peptide 1 receptor (GLP-1R) - ... Glucagon-like peptide 2 receptor (GLP-2R) - binds glucagon-like peptide 2 (GLP-2) Glucagon receptor v t e (Articles lacking ... sources from August 2014, All articles lacking sources, G protein-coupled receptors, All stub articles, Transmembrane receptor ...
Glucagon-like peptide-2 receptor
... is a G protein-coupled receptor superfamily member closely related to the glucagon receptor (GLP1 receptor). Glucagon-like ... "Structure-function of the glucagon receptor family of G protein-coupled receptors: the glucagon, GIP, GLP-1, and GLP-2 ... "Entrez Gene: Glucagon-like peptide 2 receptor". Burrin DG, Petersen Y, Stoll B, Sangild P (Mar 2001). "Glucagon-like peptide 2 ... "Glucagon Receptor Family: GLP-2". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical ...
Glucagon-like peptide-1 receptor
"Structure-function of the glucagon receptor family of G protein-coupled receptors: the glucagon, GIP, GLP-1, and GLP-2 ... The glucagon-like peptide-1 receptor (GLP1R) is a receptor protein found on beta cells of the pancreas and on neurons of the ... "Glucagon Receptor Family: GLP-1". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical ... "Crystal structure of glucagon-like peptide-1 in complex with the extracellular domain of the glucagon-like peptide-1 receptor ...
Glucagon-like peptide-1 receptor agonist
... s, also known as GLP-1 receptor agonists (GLP-1-RA), incretin mimetics, or GLP-1 ... 1 April 2010). "Glucagon-like Peptide-1 receptor agonists activate rodent thyroid C-cells causing calcitonin release and C-cell ... Pinto LC, Falcetta MR, Rados DV, Leitão CB, Gross JL (20 February 2019). "Glucagon-like peptide-1 receptor agonists and ... "Comparative efficacy of glucagon-like peptide 1 (GLP-1) receptor agonists, pioglitazone and vitamin E for liver histology among ...
G protein-coupled receptor
... glucagon; acetylcholine (muscarinic effect); chemokines; lipid mediators of inflammation (e.g., prostaglandins, prostanoids, ... transmembrane domain receptors, 7TM receptors, heptahelical receptors, serpentine receptors, and G protein-linked receptors ( ... G protein-coupled receptors database List of MeSH codes (D12.776) Metabotropic receptor Orphan receptor Pepducins, a class of ... is a receptor that can bind with stimulative signal molecules, while inhibitory hormone receptor (Ri) is a receptor that can ...
Gastric inhibitory polypeptide receptor
"Structure-function of the glucagon receptor family of G protein-coupled receptors: the glucagon, GIP, GLP-1, and GLP-2 ... "Glucagon Receptor Family: GIP". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical ... Tseng CC, Zhang XY (2000). "Role of G protein-coupled receptor kinases in glucose-dependent insulinotropic polypeptide receptor ... The gastric inhibitory polypeptide receptor (GIP-R), also known as the glucose-dependent insulinotropic polypeptide receptor, ...
Glucagon
... have glucagon receptors. When glucagon binds to the glucagon receptors, the liver cells convert the glycogen into individual ... Glucagon binds to the glucagon receptor, a G protein-coupled receptor, located in the plasma membrane of the cell. The ... Secretion of glucagon is stimulated by: Hypoglycemia Epinephrine (via β2, α2, and α1 adrenergic receptors) Arginine Alanine ( ... The pancreas releases glucagon when the amount of glucose in the bloodstream is too low. Glucagon causes the liver to engage in ...
Free fatty acid receptor 2
This stimules these cells to secrete GLP-1 (i.e., glucagon-like peptide-1) and PYY (i.e., peptide YY) into the blood. GLP-1 ... Free fatty acid receptor 2 (FFAR2), also termed G-protein coupled receptor 43 (GPR43), is a rhodopsin-like G-protein coupled ... A study treated non-diabetic, healthy men with the GLP-1 receptor antagonist (i.e., blocker of receptor activation) exendin(9- ... sialic acid receptors along with their attached viruses. A portion of the sialic acid receptor-bound virus also binds to and ...
Beta-2 adrenergic receptor
Insulin and glucagon secretion from pancreas. Inhibit histamine-release from mast cells. Increase protein content of secretions ... Other adrenergic receptors Alpha-1 adrenergic receptor Alpha-2 adrenergic receptor Beta-1 adrenergic receptor Beta-3 adrenergic ... The beta-2 adrenergic receptor (β2 adrenoreceptor), also known as ADRB2, is a cell membrane-spanning beta-adrenergic receptor ... This appears to be mediated by cAMP induced PKA phosphorylation of the receptor. Interestingly, Beta-2 adrenergic receptor was ...
KiSS1-derived peptide receptor
April 2014). "Glucagon regulates hepatic kisspeptin to impair insulin secretion". Cell Metabolism. 19 (4): 667-681. doi:10.1016 ... The KiSS1-derived peptide receptor (also known as GPR54 or the Kisspeptin receptor) is a G protein-coupled receptor which binds ... "KiSS1-Derived Peptide Receptors". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical ... March 1999). "Discovery of a receptor related to the galanin receptors". FEBS Letters. 446 (1): 103-107. doi:10.1016/S0014-5793 ...
Glucagon-like peptide-2
Glucagon-like peptide 2 receptor Akita, Tomomi; Kimura, Ryosuke; Akaguma, Saki; Nagai, Mio; Nakao, Yusuke; Tsugane, Mamiko; ... Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see ... "Usefulness of cell-penetrating peptides and penetration accelerating sequence for nose-to-brain delivery of glucagon-like ... by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like ...
Semaglutide
... is a glucagon-like peptide-1 receptor agonist. By mimicking the action of the incretin glucagon-like peptide-1 (GLP ... April 2010). "Glucagon-like Peptide-1 receptor agonists activate rodent thyroid C-cells causing calcitonin release and C-cell ... Semaglutide is a glucagon-like peptide-1 receptor agonist. The most common side effects include nausea, vomiting, diarrhea, ... Doggrell SA (March 2018). "Semaglutide in type 2 diabetes - is it the best glucagon-like peptide 1 receptor agonist (GLP-1R ...
Mahvash disease
Some patients with "glucagon cell hyperplasia and neoplasia" do not have glucagon receptor mutations. Most patients with ... The loss of normal glucagon signaling (particularly in the liver) due to inactive glucagon receptor results in enzymatic ... "Glucagon cell hyperplasia and neoplasia with and without glucagon receptor mutations". The Journal of Clinical Endocrinology ... Zhou C, Dhall D, Nissen NN, Chen CR, Yu R (November 2009). "Homozygous P86S mutation of the human glucagon receptor is ...
Amylin Pharmaceuticals
Garber, Alan J. (2011-05-01). "Long-Acting Glucagon-Like Peptide 1 Receptor Agonists". Diabetes Care. 34 (Supplement 2): S279- ... Exendin-4 is similar to the human gut hormone GLP-1, which is responsible for regulating insulin and glucagon release. Unlike ...
Secretin receptor family
IPR001749 GIPR Glucagon receptor InterPro: IPR003291 GCGR Glucagon receptor-related InterPro: IPR003290 GLP1R; GLP2R; Growth ... Subfamily B1 contains classical hormone receptors, such as receptors for secretin and glucagon, that are all involved in cAMP- ... The secretin-receptor family of GPCRs include vasoactive intestinal peptide receptors and receptors for secretin, calcitonin ... July 2013). "Structure of the human glucagon class B G-protein-coupled receptor". Nature. 499 (7459): 444-9. Bibcode:2013Natur. ...
Glutamate receptor
Pancreatic islets regulating insulin and glucagon levels also express glutamate receptors. Treating diabetes via glutamate ... NMDA receptors rely on the EPSC produced by AMPA receptors to open. NMDA receptors are permeable to Ca2+, which is an important ... Taste receptors of the T1R family, belonging to the same class of GPCR as metabotropic glutamate receptors are involved. ... Glutamate receptors are synaptic and non synaptic receptors located primarily on the membranes of neuronal and glial cells. ...
Protein-ligand complex
One of these examples is the Glucagon receptor (GCGR). Glucagon receptor (GCGR) is a family of G-protein coupled receptors ( ... Glucagon receptor inhibitors are promising for the treatment of type 2 diabetes. Inhibitors of Glucagon receptors are either ... "Glucagon Receptor Signaling and Glucagon Resistance". International Journal of Molecular Sciences. 20 (13): 3314. doi:10.3390/ ... "Interaction of Glucagon G-Protein Coupled Receptor with Known Natural Antidiabetic Compounds: Multiscoring In Silico Approach ...
Robert Margolskee
"Gut-expressed gustducin and taste receptors regulate secretion of glucagon-like peptide-1". Proceedings of the National Academy ... "A transient receptor potential channel expressed in taste receptor cells". Nature Neuroscience. 5 (11): 1169-76. doi:10.1038/ ... Margolskee's laboratory discovered the T1r3 sweet taste receptor in 2001 and the Trpm5 cation channel in 2002. Much of his ... encoding a new candidate taste receptor, is allelic to the sweet responsiveness locus Sac". Nature Genetics. 28 (1): 58-63. doi ...
Tom Blundell
He has related his structure for glucagon to receptor binding of this hormone. In chemically modified insulins he has studied ... "X-ray analysis of glucagon and its relationship to receptor binding". Nature. 257 (5529): 751-757. Bibcode:1975Natur.257..751S ... S2CID 4183707.{{cite journal}}: CS1 maint: multiple names: authors list (link) "Glucagon Molecule-of-the-Month". Pdb101.rcsb. ... Blundell has made contributions to the structural biology of polypeptide hormones, growth factors, receptor activation, signal ...
Diabetes medication
Glucagon-like peptide (GLP) agonists bind to a membrane GLP receptor. As a consequence, insulin release from the pancreatic ... Müller G, Wied S, Frick W (July 2000). "Cross talk of pp125(FAK) and pp59(Lyn) non-receptor tyrosine kinases to insulin-mimetic ... Shyangdan DS, Royle P, Clar C, Sharma P, Waugh N, Snaith A (October 2011). "Glucagon-like peptide analogues for type 2 diabetes ... The two main candidate molecules that fulfill criteria for being an incretin are glucagon-like peptide-1 (GLP-1) and gastric ...
GNAT3
2007). "Gut-expressed gustducin and taste receptors regulate secretion of glucagon-like peptide-1". Proc. Natl. Acad. Sci. U.S. ... 2002). "Human receptors for sweet and umami taste". Proc. Natl. Acad. Sci. U.S.A. 99 (7): 4692-6. Bibcode:2002PNAS...99.4692L. ... 2006). "Mechanism of the receptor-catalyzed activation of heterotrimeric G proteins". Nat. Struct. Mol. Biol. 13 (9): 772-7. ... 1999). "Ggamma13 colocalizes with gustducin in taste receptor cells and mediates IP3 responses to bitter denatonium". Nat. ...
Penetration enhancer
"Transcellular stomach absorption of a derivatized glucagon-like peptide-1 receptor agonist". Science Translational Medicine. 10 ...
Patrik Rorsman
"Glucose-inhibition of glucagon secretion involves activation of GABAA-receptor chloride channels". Nature. 341 (6239): 233-6. ... and glucagon-producing cells of the pancreatic islets regulate the plasma glucose concentration. His pioneering work is a ... Patch-clamp studies on pancreatic glucagon- and insulin-secreting cells (PhD thesis). Uppsala University. The value of the ... supervision of Nobel laureate Bert Sakmann in 1986 for patch clamp studies of pancreatic cells and their secretion of glucagon ...
Γ-Aminobutyric acid
"Glucose-inhibition of glucagon secretion involves activation of GABAA-receptor chloride channels". Nature. 341 (6239): 233-6. ... GABA receptor agonists, GABAA receptor positive allosteric modulators, Gamma-Amino acids, Glycine receptor agonists, Biology of ... Two general classes of GABA receptor are known: GABAA in which the receptor is part of a ligand-gated ion channel complex GABAB ... GABA receptor modulators and at GABAA receptor#Ligands Haynes, William M., ed. (2016). CRC Handbook of Chemistry and Physics ( ...
Free fatty acid receptor 1
5) Ffar1 gene knockout mice had impaired secretion of glucagon-like peptide-1 and gastric inhibitory polypeptide into the ... Free fatty acid receptor 1 (FFAR1), also known as G-protein coupled receptor 40 (GPR40), is a rhodopsin-like G-protein coupled ... Free fatty acid receptor Free fatty acid receptor 4 GRCh38: Ensembl release 89: ENSG00000126266 - Ensembl, May 2017 GRCm38: ... an orally available G protein-coupled receptor 40/free fatty acid receptor 1 agonist, enhances glucose-dependent insulin ...
Colworth Medal
Houslay, M. D. (1986). "Insulin, glucagon and the receptor-mediated control of cyclic AMP concentrations in liver. Twenty- ... Hardingham, G. E. (2009). "Coupling of the NMDA receptor to neuroprotective and neurodestructive events". Biochemical Society ...
Danuglipron
June 2022). "A Small-Molecule Oral Agonist of the Human Glucagon-like Peptide-1 Receptor". Journal of Medicinal Chemistry. 65 ( ... "Efficacy and Safety of Oral Small Molecule Glucagon-Like Peptide 1 Receptor Agonist Danuglipron for Glycemic Control Among ... Glucagon-like peptide-1 receptor agonists, Nitriles, Fluoroarenes, Pyridines, Ethers, Piperidines, Oxetanes, Benzimidazoles, ...
Hanmi Pharm
... a long-acting glucagon-like peptide-1 receptor agonist; an insulin intended to be delivered once per week, and a fixed-dosed ... An exclusive license outside of South Korea and China with Sanofi for Hanmi's Glucagon-like peptide-1 receptor agonist drug ...