*  Container of African Clawed Frogs (Xenopus Laevis Poster
Xenopus Laevis Posters & Prints in all sizes. 1000s of designs & options available, or custom create your own! ... Container of African Clawed Frogs (Xenopus Laevis Poster. Add to Favorites Add to List Add to List ... Container of African Clawed Frogs (Xenopus Laevis Pricing By Style and Size. Poster. Wall Decal. Mounted Print. Canvas Art. ... Interests: Styles And Patterns , Design Themes , Colors , Black , Black Background , Container of African Clawed Frogs (Xenopus ...
  http://www.cafepress.com/+container_of_african_clawed_frogs_xenopus_laevis_large_poster,841759060
*  RING finger protein - Xenopus laevis (African clawed frog)
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Xenopus laevis (African clawed frog). Nanorana parkeri. 526. ... Xenopus laevis (African clawed frog)Imported. ,p>Information which has been imported from another database using automatic ... Xenopus laevis (African clawed frog). 518. UniRef90_Q6NUE7. Cluster: LOC397846 protein. 2. ... tr,Q91884,Q91884_XENLA RING finger protein OS=Xenopus laevis PE=2 SV=1 ...
  http://www.uniprot.org/uniprot/Q91884
*  Xenopus Laevis: Frog Antibody Reactivity | Cell Signaling
Visit CellSignal.com to view our Xenopus Laevismaterials including Frog Antibody Reactivity & more. CST - Customer satisfaction ... Species Reactivity: Xenopus Model Organism: Xenopus laevis (frog). The products listed below have been validated for use with ... Xenopus samples. If there is another antibody you are interested in using for this model organism, please contact our technical ...
  https://www.cellsignal.com/browse/xenopus?N=4294960394+4294956287
*  Purification of the MeCP2/Histone Deacetylase Complex from Xenopus laevis | SpringerLink
Jones P.L., Wade P.A., Wolffe A.P. (2002) Purification of the MeCP2/Histone Deacetylase Complex from Xenopus laevis. In: Ward A ... Here, we describe techniques for purifying the MeCP2-contining histone deacetylase complex from Xenopus laevis oocytes. ... A multiple subunit Mi-2 histone deacetylase from Xenopus laevis cofractionates with an associated Snf2 superfamily ATPase. Curr ... Shimamura, A.and Worcel, A. (1989) The assembly of regularly spaced nucleosomes in the Xenopus oocyte S-150 extract is ...
  https://link.springer.com/protocol/10.1385/1-59259-211-2:297
*  Figure 4.8, [A clone of Xenopus laevis...]. - Developmental Biology - NCBI Bookshelf
A clone of Xenopus laevis frogs. The nuclei for all the members of this clone came from a single individual-a female tailbud- ... A clone of Xenopus laevis frogs. The nuclei for all the members of this clone came from a single individual-a female tailbud- ...
  https://www.ncbi.nlm.nih.gov/books/NBK10131/figure/A554/?report=objectonly
*  Cold Spring Harbor Lab Press Xenopus laevis
Manipulating the Early Embryo of Xenopus laevis: A Video Guide. Edited By Robert M. Grainger, University of Virginia, ... Early Development of Xenopus laevis: A Laboratory Manual. By Hazel L. Sive, Whitehead Institute for Biomedical Research; Robert ...
  https://www.cshlpress.com/default.tpl?cart=130520132853361399&id1=107&startat=1&--woSECTIONSdatarq=107&--SECTIONSword=ww&sortby_1=recency
*  tnfrsf12a - Fn14 - Xenopus laevis (African clawed frog) - tnfrsf12a gene & protein
Xenopus laevis (African clawed frog). Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). 120. UniRef50_Q6SIX7. ... Xenopus laevis (African clawed frog)Imported. ,p>Information which has been imported from another database using automatic ... tr,Q6SIX7,Q6SIX7_XENLA Fn14 OS=Xenopus laevis OX=8355 GN=tnfrsf12a PE=1 SV=1 ...
  http://www.uniprot.org/uniprot/Q6SIX7
*  nbn - Nibrin - Xenopus laevis (African clawed frog) - nbn gene & protein
Xenopus laevis (African clawed frog). Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). 763. UniRef50_Q6XV80. ... Xenopus laevis (African clawed frog)Imported. ,p>Information which has been imported from another database using automatic ... tr,Q6XV80,Q6XV80_XENLA Nibrin OS=Xenopus laevis GN=nbn PE=1 SV=1 MWRLVAESAAGGTYHFLTGTDYVVGRKNCAILIPEDQSISRCHATLSVSHPSANLGQTNA ...
  http://www.uniprot.org/uniprot/Q6XV80
*  gucy2c - Guanylate cyclase - Xenopus laevis (African clawed frog) - gucy2c gene & protein
Xenopus laevis (African clawed frog)Imported. ,p>Information which has been imported from another database using automatic ... tr,P79991,P79991_XENLA Guanylate cyclase OS=Xenopus laevis GN=gucy2c PE=2 SV=1 ...
  http://www.uniprot.org/uniprot/P79991
*  The glomus cell of the carotid labyrinth of Xenopus laevis.
Xenopus laevis. These cells show many catecholamine containing granules. About 50 cells in groups of 3-5 are located near the ... The ultrastructure of the glomus cells of the carotid labyrinth was investigated in the anuran, Xenopus laevis. These cells ...
  http://www.biomedsearch.com/nih/glomus-cell-carotid-labyrinth-Xenopus/7105145.html
*  Biochemical changes in developmentally retarded Xenopus laevis larvae | Development
Biochemical changes in developmentally retarded Xenopus laevis larvae Message Subject (Your Name) has sent you a message from ... Premetamorphic tadpoles of Xenopus laevis reared in water containing 0·01% propylthiouracil are developmentally retarded and ...
  http://dev.biologists.org/content/46/1/215
*  African clawed frog (Xenopus laevis) longevity, ageing, and life history
Genus: Xenopus. Species. Xenopus laevis. Common name. African clawed frog. Lifespan, ageing, and relevant traits. Maximum ... 2017), The African clawed frog Xenopus laevis: A model organism to study regeneration of the central nervous system (PubMed) ... AnAge entry for Xenopus laevis Classification (HAGRID: 00085). Taxonomy. Kingdom: Animalia. Phylum: Chordata. Class: Amphibia ( ... 0010] Brocas and Verzar (1961), The aging of Xenopus laevis, a South African frog (PubMed) ...
  http://genomics.senescence.info/species/entry.php?species=Xenopus_laevis
*  Xenbase Clone: Summary for P014 [species: Xenopus laevis]
Xenbase: The Xenopus laevis and X. tropicalis resource.. Version: 4.9.2 © Xenbase 2005-Tue Aug 14 00:25:17 MDT 2018 ... External Dbs: Unigene laevis cDNA library. Description: A subtracted cDNA library was made from corneas undergoing ...
  http://www.xenbase.org/geneExpression/showclone.do?method=displayCloneSummary&cloneId=1619310
*  Xenbase Clone: Summary for L009 [species: Xenopus laevis]
Xenbase: The Xenopus laevis and X. tropicalis resource.. Version: 4.8.0 © Xenbase 2005-2018 ... External Dbs: Unigene laevis cDNA library. Description: A subtracted cDNA library was made from corneas undergoing ...
  http://www.xenbase.org/geneExpression/showclone.do?method=displayCloneSummary&cloneId=1619778
*  Xenbase Clone: Summary for M073 [species: Xenopus laevis]
External Dbs: Unigene laevis cDNA library. Description: A subtracted cDNA library was made from corneas undergoing ...
  http://www.xenbase.org/geneExpression/showclone.do?method=displayCloneSummary&cloneId=1619602
*  Xenbase Clone: Summary for FoxK2 [species: Xenopus laevis]
Click here to close Hello! We notice that you are using Internet Explorer, which is not supported by Xenbase and may cause the site to display incorrectly. We suggest using a current version of Chrome, FireFox, or Safari. ...
  http://www.xenbase.org/geneExpression/showclone.do?method=displayCloneSummary&cloneId=12442400
*  meis1 - Homeobox protein Meis1 - Xenopus laevis (African clawed frog) - meis1 gene & protein
Xenopus laevis (African clawed frog). ,p>This subsection of the 'Names and taxonomy' section shows the unique identifier ... "Pbx1 and Meis1 regulate activity of the Xenopus laevis Zic3 promoter through a highly conserved region.". Kelly L.E., Carrel T. ... sp,P79937,MEIS1_XENLA Homeobox protein Meis1 OS=Xenopus laevis GN=meis1 PE=1 SV=1 ... "Xmeis1, a protooncogene involved in specifying neural crest cell fate in Xenopus embryos.". Maeda R., Mood K., Jones T.L., ...
  http://www.uniprot.org/uniprot/P79937
*  metap1 - Methionine aminopeptidase 1 - Xenopus laevis (African clawed frog) - metap1 gene & protein
Xenopus laevis (African clawed frog). Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). 385. UniRef90_Q7ZWV9. ... Xenopus laevis (African clawed frog). Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Varroa jacobsoni (Varroa ... Xenopus laevis (African clawed frog). 385. UniRef100_Q7ZWV9. Cluster: Methionine aminopeptidase 1. 2. ... sp,Q7ZWV9,MAP1_XENLA Methionine aminopeptidase 1 OS=Xenopus laevis OX=8355 GN=metap1 PE=2 SV=2 ...
  http://www.uniprot.org/uniprot/Q7ZWV9
*  KEGG PATHWAY: Progesterone-mediated oocyte maturation - Xenopus laevis (African clawed frog)
Progesterone-mediated oocyte maturation - Xenopus laevis (African clawed frog) [ Pathway menu , Organism menu , Pathway entry ... Xenopus oocytes are naturally arrested at G2 of meiosis I. Exposure to either insulin/IGF-1 or the steroid hormone progesterone ...
  http://www.genome.jp/kegg-bin/show_pathway?xla04914+378699
*  ctnna1 - Alpha(E)-catenin - Xenopus laevis (African clawed frog) - ctnna1 gene & protein
Xenopus laevis (African clawed frog)Imported. ,p>Information which has been imported from another database using automatic ... Xenopus laevis (African clawed frog). 903. UniRef100_Q91682. Cluster: Alpha(E)-catenin. 4. ... tr,Q91682,Q91682_XENLA Alpha(E)-catenin OS=Xenopus laevis GN=ctnna1 PE=1 SV=1 ...
  http://www.uniprot.org/uniprot/Q91682
*  Cingulin - Wikipedia
Cordenonsi M, Turco F, D'atri F, Hammar E, Martinucci G, Meggio F, Citi S (September 1999). "Xenopus laevis occludin. ... In Xenopus laevis embryos, maternal cingulin is recruited to apical cell-cell junctions from 2-cells stage. In 2004, a protein ... Fesenko I, Kurth T, Sheth B, Fleming TP, Citi S, Hausen P (August 2000). "Tight junction biogenesis in the early Xenopus embryo ... "Human and Xenopus cingulin share a modular organization of the coiled-coil rod domain: predictions for intra- and ...
  https://en.wikipedia.org/wiki/Cingulin
*  Amphibian - Wikipedia
Crayon, John J. "Xenopus laevis". AmphibiaWeb. Retrieved October 8, 2012. Moodie, G. E. E. (1978). "Observations on the life ... Snakes have been observed yawning and gaping when trying to swallow African clawed frogs (Xenopus laevis), which gives the ... Barthalmus, G. T.; Zielinski W. J. (1988). "Xenopus skin mucus induces oral dyskinesias that promote escape from snakes". ...
  https://en.wikipedia.org/wiki/Amphibian
*  Tim Hunt - Wikipedia
Cockerill, Matthew James (1996). D-type cyclins in Xenopus laevis. ucl.ac.uk (PhD thesis). University College London. OCLC ... Gautier, J.; Minshull, J.; Lohka, M.; Glotzer, M.; Hunt, T.; Maller, J.L. (1990). "Cyclin is a component of MPF from Xenopus". ... Mochida, Satoru; Hunt, Tim (2007). "Calcineurin is required to release Xenopus egg extracts from meiotic M phase". Nature. 449 ... in cell-free extracts of Xenopus oocytes and eggs". EMBO J. 12: 1979-1986. PMC 413419 . PMID 8387916. Craig, D.; Howell, M.T.; ...
  https://en.wikipedia.org/wiki/Tim_Hunt
*  SPDYE1 - Wikipedia
Speedy homolog E1 (Xenopus laevis) is a protein that in humans is encoded by the SPDYE1 gene. This gene is located at ... Xenopus laevis)". Dinarina A, Perez LH, Davila A, Schwab M, Hunt T, Nebreda AR (March 2005). "Characterization of a new family ...
  https://en.wikipedia.org/wiki/SPDYE1