*  Papaveraceae - The Lycaeum
Subfamily Fumarioideae Eaton * Tribe Hypecoeae Dumort. * Hypecoum L. - Mediterranean region to Mongolia and Western China. ... The Papaveraceae /pəpeɪvəˈreɪsiː/ or /pəpɑːvəˈreɪsiː/, informally known as the poppy family, are an economically important ... dividing the Papaveraceae into only two subfamilies.[4] The internal division of the Fumarioideae shown below follows Lidén ( ... 1997).[3] In the latter study, the Eschscholzieae tribe would be the basal clade and sister group to the rest of the subfamily ...
  http://www.lycaeum.org/wiki/Papaveraceae
*  Papaveraceae - Wikipedia
For discussions of subfamilies, see Carolan et al. (2006) and Blattner & Kadereit (1999). Subfamily Fumarioideae Eaton Tribe ... dividing the Papaveraceae into only two subfamilies. The internal division of the Fumarioideae shown below follows Lidén (1993 ... Subfamily Papaveroideae Eaton Tribe Eschscholzieae Baill. Dendromecon Benth. - California. Eschscholzia Cham. - Western North ... 1997). In the latter study, the Eschscholzieae tribe would be the basal clade and sister group to the rest of the subfamily, ...
  https://en.wikipedia.org/wiki/Papaveraceae
*  ALKALOIDS OF PAPAVERACEAE (XIII).' ALKALOIDS OF PAPAVER F UGAX POPULATION KHALKHAL AND PAPAVER CA UCASICUM POPULATION ELIKA
Papaver fugax Poiret population Khalkhal was shown to contain four major alkaloids, roemerine (0.19%), mecamberine (0.39%), liriodenine (0.20%) and salutaridine (0.10%). Papaver caucasicum M. B. population Elika was shown to contain four major alkaloids, nuciferine (0.50%), amurensinine (0.15%), lysicamine (0.30%) and nornuciferine (0.40%). Lysicarnine and nornuciferine were detected for the first time in Papaveraceae
  https://jsciences.ut.ac.ir/article_31135.html
*  Macleaya Cordata Extract/China Herb Extract Company Supply 10~50% Sanguinarine & Chelerythrine( Alka - Products - Shaanxi Bolin...
Product Name:Macleaya Cordata ExtractsSpecifications: 10%, 20%, 50%,60%(Alkaloids)10%- 80%(Sanguinarine)10%, 20%, 50%(Chelerythrine)Appearance: Orange powder Grade: Pharmaceutical and Food GradeTest Mothed: HPLC/TLC
  http://www.matlockdrains.com/com/somy361/sell/itemid-35073.html
*  Fumarioideae | Article about Fumarioideae by The Free Dictionary
Looking for Fumarioideae? Find out information about Fumarioideae. A family of dicotyledonous plants in the order Papaverales having four or six stamens, irregular flowers, and no latex system. a family of dicotyledonous... Explanation of Fumarioideae
  http://encyclopedia2.thefreedictionary.com/Fumarioideae
*  PAPAVERACEAE
Characteristics of this Plant Family: Leaves, Stem & Roots ~ The leaves of plants in this family are entire, but often deeply cut, and arise alternately up the stem. The stem may be smooth, hairy, or prickly. The sap is a milky latex, and it is this which gave the family its name - pappa is the Latin for food or milk. Instead of the normal calyx, members of this Family have two large sepals which enclose the flower bud, and these fall off when the bud opens. Flowers ~ There are two rings of two large, rounded petals, except in Macleaya (Plume Poppy) and some tropical species. The petals are often crumpled inside the bud. There are many rows of stamens. Seeds ~ The seeds develop inside a rounded capsule with one chamber, which opens by small holes around the lid. Members of this Family usually have: Two sepals enclosing the flower bud, which fall off when it opens ...
  http://theseedsite.co.uk/papaveraceae.html
*  Papaveraceae - Frostburg State University
Family Description:. This is a family of herbaceous plants that can be annual, perennial, or biennial. The leaves are usually alternate or basally arranged and deeply divided. The flowers are mostly solitary, irregular and showy with bilateral symmetry. The fruit is a capsule and many members of this family are considered toxic due to the alkaloids they contain.. Plants in Family:. ...
  https://www.frostburg.edu/ethnobotany/herbarium-collection/family/papaveraceae/
*  Polyphenolic and biological activities of leaves extracts of Argemone subfusiformis (Papaveraceae) and Urtica urens (Urticaceae)
Nowadays there is a resurgence of interest in wild plants for their possible medicinal value in diets, since some epidemiological studies have demonstrated their effectiveness against important diseases. Generally, foods of plant origin contain many bioactive compounds, proteins, energy, vitamins and specific minerals; in addition, the popular wild plant species provide fibre, essential fatty acids and enhance the taste and colour in diets. We studied the nutritional and medicinal potential of leaves of A. subfusiformis and U. urens, collected in Alice, South Africa in November 2006. To asses this we analyzed the phytochemical, antioxidant and antibacterial activities of leaves in acetone, methanol and water extracts, using standard analytical methods. The proximate analysis showed that the leaves of both plant species contained appreciable percentages of moisture; ashes; carbohydrates; crude proteins, lipids and fibres. Elemental analysis of macro and microelements showed higher values for U. ...
  http://www.kerwa.ucr.ac.cr/handle/10669/26972
*  IPNI Plant Name Details
basionym of:Papaveraceae Argemone intermedia Sweet subsp. corymbosa (Greene) A.E.Murray Kalmia 12: 18 (1982):. duplicate citation of:Papaveraceae Argemone corymbosa Greene Bull. Calif. Acad. Sci. 2: 59. 1886 Id: 671691-1 Version: 1.3 View Record history. View this record in TCS-RDF format. ...
  http://www.ipni.org/ipni/idPlantNameSearch.do?id=671691-1&back_page=%2Fipni%2FeditAdvPlantNameSearch.do
*  Categori:Papaveraceae - Wicipedia
Mae testun y dudalen ar gael dan drwydded Creative Commons Attribution-ShareAlike; gall fod telerau ychwanegol perthnasol. Gweler Telerau Defnyddio'r Drwydded am fanylion pellach ...
  https://cy.wikipedia.org/wiki/Categori:Papaveraceae
*  Open Journal of Animal Sciences
div style=line-height:22px; width=100%,,b,Residue Study for a Standardized ,i,Macleaya cordata,/i, Extract in Growing-Finishing Swine,/b,,br,,i,Macleaya cordata,/i, Extract, Swine, Sanguinarine, Tolerability, Residues,br,,a href=http://www.scirp.org/journal/PaperInformation.aspx?paperID=75314 target=_blank,Paper Information,/a, Full Paper: ,a href=http://www.scirp.org/journal/PaperDownload.aspx?FileName=OJAS_2017041014411791.pdf&paperID=75314,PDF,/a, (Size:352KB),br,DOI: 10.4236/ojas.2017.72008,br,,br,,b,Performance, Immune, and Carcass Characteristics of Broiler Chickens as Affected by Thyme and Licorice or Enzyme Supplemented Diets,/b,,br,Broiler, Enzyme, Licorice, Thyme,br,,a href=http://www.scirp.org/journal/PaperInformation.aspx?paperID=75444 target=_blank,Paper Information,/a, Full Paper: ,a href=http://www.scirp.org/journal/PaperDownload.aspx?FileName=OJAS_2017041715254342.pdf&paperID=75444,PDF,/a, (Size:272KB),br,DOI: 10.4236/ojas.2017.72009,br,,br,,b,Bovine Endometrial Cells Mount ...
  http://file.scirp.org/Rss/OJAS.xml
*  Pacific Bulb Society | Corydalis
Corydalis is a genus of about 300 species some people consider to belong to Fumariaceae family. Others chose to include this family as a subfamily, Fumarioideae, in the Papaveraceae family. This genus is widely distributed in the Northern Hemisphere, including Europe, Asia, North America, and the mountains of Africa. Some have tubers or enlarged rhizomes, and others are strictly fibrous-rooted. The former are handily divided into woodland and scree species, for purposes of cultivation. The genus name comes from the Greek korydalís "crested lark" which roughly represents the characteristic flower shape. An excellent reference book on the geophytic species of this genus was written by Magnus Lidén and Henrik Zetterlund in 1997. A more recent (2008) guide for the genus and related genera was written by Mark Tebbitt, Lidén, and Zetterlund. The tuberous species in particular are often grown in bulb collections and are propagated by increase of ...
  http://www.pacificbulbsociety.org/pbswiki/index.php/Corydalis
*  Fumaria
Genus: Fumaria. Life , eukaryotes , Archaeoplastida , Chloroplastida , Charophyta , Streptophytina , Plantae (land plants) , Tracheophyta (vascular plants) , Euphyllophyta , Lignophyta (woody plants) , Spermatophyta (seed plants) , Angiospermae (flowering plants) , Eudicotyledons , Order: Ranunculales , Family: Papaveraceae , Subfamily: Fumarioideae. About 50 species (mainly Mediterranean, extending to central Asia, also Atlantic Islands and one in tropical Africa. There are three species naturalised in southern Africa. Fumaria officinalis (Fumitory) is native to Europe and is cultivated in the region. Previously in the Fumariaceae. ...
  http://www.biodiversityexplorer.org/plants/papaveraceae/fumaria.htm
*  Flowers of the Silk Road: QINGHAI
Sorry for a lack of posts of late, I've just returned from five weeks in China and blogs such as this are blocked there! The first half of my trip was a tour I led to Yunnan which was superb for flowers this year with many new species added. The latter half took me up into northern Sichuan and then the amazing mountains of southern Qinghai - Stone Mountain and Anyemaqen Shan. In between the thousands of sweet-scented Lilium regale and the stunning blue pools of Huanglong with copious deep pink Cypripedium tibeticum were vast grasslands with huge herds of yaks but these didn't touch the wonderful spidery flowered Cremanthodium brunneopilosum or the abundant meconopsis. It was a great trip for meconopsis with often yellow, red and blue/purple present together on various passes and on the high alpine turf of Stone Mountain the Meconopsis lancifolium were simply enormous with wide open 'bowls' of mauve-blue bristling with creamy anthers. This mountain and the rest of its jagged toothed range seemed ...
  http://flowersofthesilkroad.blogspot.com/2011/07/qinghai.html
*  Chelidonium - Wikipedia
Commons Wikispecies Chelidonium L. é um gênero botânico da família Papaveraceae. Coreanomecon Nakai Chelidonium majus (Quelidónia-maior) Lista completa (em alemão) PPP-Index (em inglês) USDA Plants Database (em inglês) Germplasm Resources Information Network (GRIN ...
  https://pt.wikipedia.org/wiki/Chelidonium
*  NK314 | CAS#208237-49-4 | Chk1 inhibitor | topoisomerase II inhibitor | MedKoo Biosciences
NK314 is a novel synthetic benzo[c]phenanthridine alkaloid that shows strong antitumor activity. It inhibited topoisomerase II activity and stabilized topoisomerase II-DNA cleavable complexes. The DNA breaks occurred within 1h after treatment with NK314 even without digestion of topoisomerase II by proteinase K, whereas etoposide required digestion of the enzyme protein in cleavable complex to detect DNA breaks. Pretreatment with topoisomerase II catalytic inhibitors, ICRF-193 and suramin, reduced both cleavable complex-mediated DNA breaks and proteinase K-independent DNA breaks, but protease inhibitors and nuclease inhibitors only decreased the latter.
  http://www.medkoo.com/products/6224
*  Poljski mak lat. Papaver rhoeas | Photo/Image by mladica | Fliiby
Cvet maka u polju pšenice. Bulka (turčinak, divlji mak) ili lat. Papaver rhoeas je jednogodišnja, ređe dvogodišnja zeljasta biljka iz porodice makova (Papaveraceae). | File name: Mak_1.jpg | Date uploaded: May 24, 2015
  https://flii.by/file/tsgxs93wvef/
*  Revealing the anti-tumoral effect of Algerian Glaucium flavum roots against human cancer cells. - Semantic Scholar
Glaucium flavum (G. flavum) is a plant from the Papaveraceae family native to Algeria where it is used in local traditional medicine to treat warts. G. flavum root crude alkaloid extract inhibited breast cancer cell proliferation and induced G2/M phase cycle arrest and apoptosis without affecting normal cells, which is a highly awaited feature of potential anti-cancer agents. G. flavum significantly reduced growth and vascularization of human glioma tumors on chicken chorioallantoic membrane (CAM) in vivo. The chromatographic profile of the dichloromethane extract of G. flavum root showed the presence of different constituents including the isoquinoline alkaloid protopine, as the major compound. We report for the first time that G. flavum extract may represent a new promising agent for cancer chemotherapy.
  https://www.semanticscholar.org/paper/Revealing-the-anti-tumoral-effect-of-Algerian-Glau-Bournine-Bensalem/4c148b72770f1f129926a41871401d92daff7ef2
*  "Mohnblüten - Poppy" by Heidasch -...
Der Klatschmohn (Papaver rhoeas), auch Mohnblume oder Klatschrose genannt, ist eine Pflanzenart aus der Familie der Mohngewächse (Papaveraceae). T.... Photo by Heidasch on Mostphotos.
  https://www.mostphotos.com/330688/mohnbluten-poppy
*  Pacific Bulb Society | Sanguinaria
Sanguinaria is a genus of the family Papaveraceae. Sanguinaria canadensis is the only species in the genus. The plant is found throughout the eastern United States into eastern Canada. It grows in forested areas which have not been disturbed. Plants flower in the spring after a freezing winter dormancy. Attached to seeds are elaiosome, a fleshy body made of mostly lipids and proteins. Ants carry these particles back to their nest for food and thus spread and plant the seed simultaneously. The common name bloodroot comes from the red sap that leaks out when the root, more technically a rhizome, is cut. Native American and modern day settlers have made use of this plant in cultural and medicinal practices. The sap is very poisonous and kills tissue, an important activity which is being investigated for anti-tumor activities. ...
  http://www.pacificbulbsociety.org/pbswiki/index.php/Sanguinaria
*  Seedlist M
PAPAVERACEAE. Hardy annuals, biennials and perennials grown for their large showy flowers, which are produced in profusion from June to September. Excellent in the border, rock, and wild garden. Most are hardy, and prefer a moist, partly shady position, but with well drained soil that will not get soggy in winter. Some require a cool moist summer, and planting these on the north side of a stone will help provide a cool root zone. Equal parts peat, leaf mold and sand a foot deep is recommended. Best grown from seed. The perennials are deep rooted and long-lived and should not be disturbed once established. The monocarpic (seeding only once) biennial and triennial species can sometimes be flowered for several years if the first flower-buds are cut out. Sow annuals early and plant out at the end of April. The biennials and perennials should be started in flats on the North side of the house or other cool, shaded place. These will benefit greatly from one week of cold treatment if sown in ...
  http://jlhudsonseeds.net/SeedlistM.htm
*  Depside - Wikipedia
Un depside è un tipo di composto polifenolico costituito da due o più unità aromatiche monocicliche collegate da legami esterei. I depsidi sono più frequentemente rinvenuti nei licheni, ma sono stati isolati anche dalle piante vascolari più evolute, incluse le specie delle Ericaceae, delle Lamiaceae, delle Papaveraceae e delle Myrtaceae. I depsidi possiedono proprietà antibiotica, anti-HIV, antiossidante e anti-proliferativa. Come inibitori della sintesi delle prostaglandine e della biosintesi del leucotriene B4, i depsidi sono potenti farmaci antinfiammatori non steroidei. Una depsidasi è un tipo di enzima, che taglia i legami depsidici. Uno di questi enzimi è la tannasi. L'acido giroforico, che si trova nel lichene Cryptothecia rubrocincta, è un depside. acido lecanorico - acido 4-(2,4-diidrossi-6-metilbenzoil)ossi-2-idrossi-6-metilbenzoico acido giroforico - acido 4-[4-(2,4-diidrossi-6-metilbenzoil)ossi-2-idrossi-6-metilbenzoil]ossi-2-idrossi-6-metilbenzoico acido salazinico - ...
  https://it.wikipedia.org/wiki/Depside
*  Sanguinaria canadensis - Wikibooks, open books for an open world
The United States FDA has approved the inclusion of sanguinarine in toothpastes as an antibacterial or anti-plaque agent.[4][5][6][7] Currently, it is believed that this use may cause leukoplakia, a premalignant oral lesion.[8] On 24 Nov 2003, the Colgate-Palmolive Company commented by memorandum (see: PDF file) to the United States Food and Drug Administration that then-proposed rules for levels of sanguinarine in mouthwash and dental wash products were lower than necessary. Professor George T. Gallagher also commented from his post at Boston University Goldman School of Dental Medicine, see his memorandum[1] of 23 June 2003.. Sangrovit® is an animal food additive sold and distributed in Europe. Sangrovit is manufactured by Germany-based Phytobiotics. Sangrovit contains sanguinarine and chelerythrine. On 14 May 2003, Cat Holmes reported in the Georgia Faces[9] that Jim Affolter and Selima Campbell, horticulturists at the University of Georgia College of Agricultural and Environmental Sciences, ...
  https://en.m.wikibooks.org/wiki/Horticulture/Sanguinaria_canadensis
*  Blue Himalayan Poppy
This Hardy Geranium (Geranium 'Brookside' cultivar), also known as Cranesbill, is a deciduous, herbaceous perennial that forms a neat mound that is about 18″ high and wide. Flowering begins in spring. If you cut it back after flowering, it should bloom again in the summer. It makes a great filler for mixed borders or full-sun perennial beds and grows well in containers. It prefers full sun but can tolerate part shade for half of the day. It does best in moist, well-drained soil. Hardy in zones 5-8.. Salvias also provide that saturated blue color that gardeners seek. Look for Mealycup Sage (Salvia farinacea 'Victoria Blue'), a member of the mint family. This herbaceous perennial is commonly grown as an annual in cold areas. Striped Squill (Puschkinia libanotica) is a beautiful spring bulb flower growing just 4-5 inches tall, with pale white-blue petals with darker blue center stripes. If you're an Iris fan, look for the lovely blossoms of the Giant Blue Flag Louisiana Iris (Iris ...
  http://www.flowershopnetwork.com/blog/tag/blue-himalayan-poppy/
*  Lia Leendertz: Changing seasons | Life and style | The Guardian
Lia Leendertz: Now summer is here, my old adversary, the Welsh poppy (Meconopsis cambrica), has returned to charm me into believing that bright yellow and orange are restrained and sophisticated.
  https://www.theguardian.com/lifeandstyle/2006/jun/03/gardens
*  KEGG T01331: SCHCODRAFT 53697
scm:SCHCODRAFT_53697 K10777 DNA ligase 4 [EC:6.5.1.1] , (RefSeq) DNA ligase IV-like protein (A) MQATPAPTEAPGSPQPSQTTASQQPFPEQPYNTDTLPFHILTAFFEKLQGERKQEKRRKL LNHWFNKWREDNGPDLYPVLRLILPHRDRERNVYGLKEKALAKLYIKVIPLNKNDPDAMR LLYWKKPTEKHASTCASSAASGDFPTVLYEVVSKRSSVTQSTLTIDDINDMLDQLADMSN KSEKQSKIIQRLYNEATPEQQLWFARIILKDMNISVKETTVFAVFHPDAQALYNTCSDLK KVAWQLADPSIRLHEDEKQVKLGQPFMPMLCKRPMKRIEDTAQEMDGSEFIIEEKLDGER MQLHKMGNQYYYSSRKGKDYTYLYGSHVGAGSLTPYIAHRFHKQADSAILDGEMLVWDPI SGRNLPFGTLKTAALDQSKKQAAPRPCLKVFDLLYLNGKSLIDKSTAFRKKNMRLVIEAL PGRIEFVDEFKGRTAQDIREKMDEVMANRGEGLVIKHPKSQYVLNGRNNDWIKVKPEYMD NMGETVDVLVVAGNYGSGRRSGGVSTLICAVFDDRNTGSFNENESKYATFVRVGSGLTYA DYMWLRAKNWKTWDAKNSPTYLQTAKRSHEDKGDVYLEYEDTFILKVKAAEITPSDQYHV RYTMRFPRALSIREEMAPGDCMTASAVVEQLKTAKKRKMETNKVSSTKKRKVVKKKVEML PRFDGPDMKDVKEESDLFKGMKFVVISDPKARTGEEDRKKLMKLIRSHGGQCPQFAKDPA AIVVYNGTSTPYDLQLIIRKDTNDVVRPQWVMDCIAKGELVPMEKKYFFFATTARKETAE YGEDGGAESSGSVTQESSDDEAAAETSQSSKKRKRAGKSAEPETQDKTADEEKATPAPSK PKVDLDPGLAAWLGYDEDDAAGVEDDAGEKDERGGRDDVESDNDSDNQDVKDEEEEDDMA ...
  http://www.genome.jp/dbget-bin/www_bget?-f+-n+a+scm:SCHCODRAFT_53697