Loading...
*  "The Role of Inducible T Cell Kinase (Itk) in the Development of Innate" by Amanda L. Prince
One of these signaling proteins, inducible T cell kinase (Itk) is a nonreceptor protein tyrosine kinase that signals downstream ... in several strains of mice harboring mutations in T cell signaling proteins or transcriptional regulators, conventional CD8+ T ... One of these signaling proteins, inducible T cell kinase (Itk) is a nonreceptor protein tyrosine kinase that signals downstream ... Dissertations, UMMS; Protein-Tyrosine Kinases; Immunity, Innate; CD4-Positive T-Lymphocytes; CD8-Positive T-Lymphocytes ...
  http://escholarship.umassmed.edu/gsbs_diss/660/
*  pp60(c-src) and related tyrosine kinases: a role in the assembly and reorganization of matrix adhesions :: MPG.PuRe
Focal Adhesion Kinase 1; Focal Adhesion Protein-Tyrosine Kinases; Focal Adhesions/drug effects/enzymology/metabolism; Gene ... Protein-Tyrosine Kinases/antagonists & inhibitors/metabolism; Proto-Oncogene Proteins/antagonists & inhibitors/metabolism; ... src-Family Kinases/antagonists & inhibitors/*metabolism; Titel: pp60(c-src) and related tyrosine kinases: a role in the ... Proto-Oncogene Proteins c-fyn; Proto-Oncogene Proteins c-yes; Proto-Oncogene Proteins pp60(c-src)/antagonists &; inhibitors/ ...
  http://pubman.mpdl.mpg.de/pubman/faces/viewItemOverviewPage.jsp?itemId=escidoc:1813939
*  RON Receptor Tyrosine Kinase, a Negative Regulator of Inflammation, Is Decreased during Simian Immunodeficiency Virus...
Macrophage-stimulating protein, the ligand for the stem cell-derived tyrosine kinase/RON receptor tyrosine kinase, inhibits IL- ... Activation of the stem cell-derived tyrosine kinase/RON receptor tyrosine kinase by macrophage-stimulating protein results in ... independent mechanisms for mitogen-activated protein kinase activation by the murine Ron receptor tyrosine kinase. J. Biol. ... receptor tyrosine kinase, a member of the MET proto-oncogene family of receptor tyrosine kinases, functions to maintain ...
  http://www.jimmunol.org/content/191/8/4280.long
*  Src Family Kinase Activity Is Required for Kit-mediated Mitogen-activated Protein (MAP) Kinase Activation, However Loss of...
... mitogen-activated protein; ERK, extracellular signalregulated kinase; MEK, MAP/ERK kinase; RTK, receptor tyrosine kinase; WT, ... Expression and Prognostic Significance of Kit, Protein Kinase B, and Mitogen-activated Protein Kinase in Patients with Small ... Assembly of cyclin D-dependent kinase and titration of p27 Kip1 regulated by mitogen-activated protein kinase kinase (MEK1). ... The predicted kinase activities of the mutant Lck proteins were confirmed by IP kinase assays as described previously (21) . ...
  http://cgd.aacrjournals.org/cgi/content/full/11/6/305
*  OriGene - Search All Products
Protein. Recombinant protein of human lymphocyte-specific protein tyrosine kinase (LCK), transcript variant 2 $680. In Stock. ... LCK (untagged)-Kinase deficient mutant (K273M) of Human lymphocyte-specific protein tyrosine kinase (LCK), transcript variant 2 ... Lenti ORF clone of Human lymphocyte-specific protein tyrosine kinase (LCK), transcript variant 2, mGFP tagged $900. 2-3 weeks. ... Lenti ORF clone of Human lymphocyte-specific protein tyrosine kinase (LCK), transcript variant 2, mGFP tagged $900. 3-4 weeks. ...
  http://www.origene.com/cdna/search-nm.aspx?accn=NM_005356&species=Human&product=ALL
*  Oncogenic protein tyrosine kinases | SpringerLink
Signals through Kit receptor tyrosine kinase are essential for development of erythrocytes, melanocytes, germ cells, mast cells ... Signals through Kit receptor tyrosine kinase are essential for development of erythrocytes, melanocytes, germ cells, mast cells ...
  https://link.springer.com/article/10.1007%2Fs00018-004-4273-y
*  Patent US7585866 - Protein tyrosine kinase inhibitors - Google Patents
... and methods of using them to treat tyrosine kinase-dependent diseases and conditions in mammals: wherein n is an integer, ... regulate and/or modulate tyrosine kinase signal transduction, compositions which contain these compounds, ... Protein tyrosine kinase inhibitors. US20090298855 *. Jul 28, 2009. Dec 3, 2009. Critical Outcome Technologies Inc.. Protein ... Tyrosine kinases can be categorized as receptor type or non-receptor type. Receptor type tyrosine kinases have an extracellular ...
  http://www.google.com/patents/US7585866?dq=6859936
*  TYRO3 (TYRO3 protein tyrosine kinase)
TYRO3 protein tyrosine kinase), Authors: Kristen M Jacobsen, Rachel MA Linger, Douglas K Graham. Published in: Atlas Genet ... tyrosine kinase activity transmembrane receptor protein tyrosine kinase activity transmembrane receptor protein tyrosine kinase ... tyrosine kinase activity transmembrane receptor protein tyrosine kinase activity transmembrane receptor protein tyrosine kinase ... FN3 (PS50853) IG_LIKE (PS50835) PROTEIN_KINASE_ATP (PS00107) PROTEIN_KINASE_DOM (PS50011) PROTEIN_KINASE_TYR (PS00109) ...
  http://atlasgeneticsoncology.org/Genes/GC_TYRO3.html
*  Protein tyrosine kinase inhibitors - Patent # 8252800 - PatentGenius
... treat tyrosine kinase-dependent diseases and conditions in mammals: ##STR00001## wherein n is an integer, preferably n is 1; ... regulate and/or modulate tyrosine kinase signal transduction, compositions which contain these compounds, and methods of using ... Tyrosine kinases can be categorized as receptor type or non-receptor type. Receptor type tyrosine kinases have an extracellular ... For example, the Bcr-Abl tyrosine kinase is the constitutiveabnormal tyrosine kinase created by the Philadelphia chromosome ...
  http://www.patentgenius.com/patent/8252800.html
*  Protein Tyrosine Kinase-6 (PTK6) | Springer for Research & Development
The intracellular protein tyrosine kinase, PTK6 (also known as the breast tumor kinase, Brk), has been implicated in the ... Breast tumor kinase (protein tyrosine kinase 6) regulates heregulin-induced activation of ERK5 and p38 MAP kinases in breast ... The intracellular protein tyrosine kinase, PTK6 (also known as the breast tumor kinase, Brk), has been implicated in the ... PTK (protein tyrosine kinase)-6 and HER2 and 4, but not HER1 and 3 predict long-term survival in breast carcinomas. Br J Cancer ...
  https://rd.springer.com/referenceworkentry/10.1007/978-1-4419-0461-4_305?page
*  Axl - Receptor protein-tyrosine kinase - Mus musculus (Mouse) - Axl gene & protein
PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. ... PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. ... IPR000719. Prot_kinase_dom. IPR017441. Protein_kinase_ATP_BS. IPR001245. Ser-Thr/Tyr_kinase_cat_dom. IPR008266. Tyr_kinase_AS. ... IPR000719. Prot_kinase_dom. IPR017441. Protein_kinase_ATP_BS. IPR001245. Ser-Thr/Tyr_kinase_cat_dom. IPR008266. Tyr_kinase_AS. ...
  http://www.uniprot.org/uniprot/Q3TTM4
*  Protein Tyrosine Kinase and Phosphatase Expression Profiling - Cancer Research | Sigma-Aldrich
Tyrosine kinases (PTK) represent only 10% of all protein kinases, although they are the most important protein kinases. PTKs ... 1998) Protein-tyrosine kinase and protein-serine/threonine kinase expression in human gastric cancer cell lines. J. Biomed. Sci ... Protein Tyrosine Kinase and Phosphatase Expression Profiling in Human Cancers. Wen-Chang Lin. Institute of Biomedical Sciences ... Robinson, D.R., Wu, Y.M., and Lin, S.F. (2000) The protein tyrosine kinase family of the human genome. Oncogene 19, 5548-5557. ...
  https://www.sigmaaldrich.com/life-science/cell-biology/cancer-research/learning-center/cancer-research-protocols/ptk-ptp-expression.html
*  EPHA4 - Receptor protein-tyrosine kinase - Homo sapiens (Human) - EPHA4 gene & protein
PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. PS50105. SAM_DOMAIN ... PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. PS50105. SAM_DOMAIN ... IPR011009. Kinase-like_dom_sf. IPR000719. Prot_kinase_dom. IPR017441. Protein_kinase_ATP_BS. IPR001660. SAM. IPR013761. SAM/ ... IPR011009. Kinase-like_dom_sf. IPR000719. Prot_kinase_dom. IPR017441. Protein_kinase_ATP_BS. IPR001660. SAM. IPR013761. SAM/ ...
  http://www.uniprot.org/uniprot/Q53TA0
*  Control of Genetically Prescribed Protein Tyrosine Kinase Activities by Environment-Linked Redox Reactions
... Izumi Nakashima, ... Izumi Nakashima, Yoshiyuki Kawamoto, Kozue Takeda, and Masashi Kato, "Control of Genetically Prescribed Protein Tyrosine Kinase ...
  https://www.hindawi.com/journals/er/2011/896567/cta/
*  RCSB PDB - Protein Feature View - Protein-tyrosine kinase 2-beta - Q14289 (FAK2 HUMAN)
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex ... ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. UniProt ... Non-receptor protein-tyrosine kinase that regulates reorganization of the actin cytoskeleton, cell polarization, cell migration ... this leads to the phosphorylation of additional tyrosine residues, creating binding sites for scaffold proteins, effectors and ...
  http://www.rcsb.org/pdb/protein/Q14289
*  Ptk2b - Protein-tyrosine kinase 2-beta - Mus musculus (Mouse) - Ptk2b gene & protein
... this leads to the phosphorylation of additional tyrosine residues, creating binding sites for scaffold proteins, effectors and ... Promotes activation of the MAP kinase signaling cascade, including activation of MAPK1/ERK2, MAPK3/ERK1 and MAPK8/JNK1. ... Promotes activation of phosphatidylinositol 3-kinase and of the AKT1 signaling cascade. Promotes activation of NOS3. Regulates ... Functions in signaling downstream of integrin and collagen receptors, immune receptors, G-protein coupled receptors (GPCR), ...
  http://www.uniprot.org/uniprot/Q9QVP9
*  Protein-tyrosine kinases | definition of protein-tyrosine kinases by Medical dictionary
What is protein-tyrosine kinases? Meaning of protein-tyrosine kinases medical term. What does protein-tyrosine kinases mean? ... Looking for online definition of protein-tyrosine kinases in the Medical Dictionary? protein-tyrosine kinases explanation free ... protein-tyrosine kinases. Also found in: Dictionary. protein-tyrosine kinases. A large class of enzymes that catalyse the ... medical-dictionary.thefreedictionary.com/protein-tyrosine+kinases',protein-tyrosine kinases,/a,. *Facebook ...
  http://medical-dictionary.thefreedictionary.com/protein-tyrosine+kinases
*  Protein Tyrosine Kinase Compound Library-MedchemExpress
Protein Tyrosine Kinase Compound Library. Cat. No.: HY-L016 Library Contents: XLSX PDF ... Protein Tyrosine Kinase Compound Library Neuronal Signaling Compound Library PI3K/Akt/mTOR Compound Library .... ... Contents of Protein Tyrosine Kinase Compound Library Plate layout: HY-L016-1 ... GPCR/G Protein Compound Library Anti-Cancer Compound Library Kinase Inhibitor Library Immuno-Oncology Compound Library ...
  https://www.medchemexpress.com/screening/Protein_Tyrosine_Kinase_Compound_Library.html
*  Tyrobp - TYRO protein tyrosine kinase-binding protein precursor - Mus musculus (Mouse) - Tyrobp gene & protein
TYRO protein tyrosine kinase-binding proteinAdd BLAST. 93. Amino acid modifications. Feature key. Position(s). Description ... sp,O54885,TYOBP_MOUSE TYRO protein tyrosine kinase-binding protein OS=Mus musculus GN=Tyrobp PE=1 SV=1 ... Protein. Similar proteins. Organisms. Length. Cluster ID. Cluster name. Size. O54885. Q3U419. A0A140LHP7. Mus musculus (Mouse) ... Protein. Similar proteins. Organisms. Length. Cluster ID. Cluster name. Size. O54885. O43914. UPI00053307B6. G3RH46. Q8WNQ8. ...
  http://www.uniprot.org/uniprot/O54885
*  Human Metabolome Database: Showing Protein Protein-tyrosine kinase 2-beta (HMDBP01425)
Showing Protein Protein-tyrosine kinase 2-beta (HMDBP01425). IdentificationBiological propertiesGene propertiesProtein ... Protein tyrosine kinase PYK2 involved in Ca(2+)-induced regulation of ion channel and MAP kinase functions. Nature. 1995 Aug 31 ... a novel protein-tyrosine kinase of the focal adhesion kinase subfamily. J Biol Chem. 1995 Sep 8;270(36):21206-19. [PubMed: ... Protein Sequence. ,Protein-tyrosine kinase 2-beta MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK ...
  http://www.hmdb.ca/proteins/HMDBP01425
*  Protein-Tyrosine Kinase Inhibitor (STI571) for Treatment of Patients With Ph+ Chronic Myeloid Leukemia - Tabular View -...
Protein-Tyrosine Kinase Inhibitor (STI571) for Treatment of Patients With Ph+ Chronic Myeloid Leukemia. The safety and ... Protein-Tyrosine Kinase Inhibitor (STI571) for Treatment of Patients With Ph+ Chronic Myeloid Leukemia Who Are Resistant to or ... Protein-Tyrosine Kinase Inhibitor (STI571) for Treatment of Patients With Ph+ Chronic Myeloid Leukemia. ...
  https://clinicaltrials.gov/ct2/show/record/NCT00511303
*  Context-specific protein tyrosine kinase 6 (PTK6) signalling in prostate cancer - Zheng - 2013 - European Journal of Clinical...
Protein tyrosine kinase 6 (PTK6) is an intracellular tyrosine kinase that is distantly related to SRC family kinases. PTK6 is ... M Peng, S M Ball-Kell, R R Franks, H Xie, A L Tyner, Protein tyrosine kinase 6 regulates mammary gland tumorigenesis in mouse ... Context-specific protein tyrosine kinase 6 (PTK6) signalling in prostate cancer. Authors. *. Yu Zheng,. *Department of ... Michael I. Chastkofsky, Wenjun Bie, Susan M. Ball-Kell, Yu-Ying He, Angela L. Tyner, Protein Tyrosine Kinase 6 Regulates UVB- ...
  http://onlinelibrary.wiley.com/doi/10.1111/eci.12050/abstract
*  PAH- and PCB-induced Alterations of Protein Tyrosine Kinase and Cytokine Gene Transcription in Harbor Seal (Phoca Vitulina) PBMC
PAH- and PCB-induced Alterations of Protein Tyrosine Kinase and Cytokine Gene Transcription in Harbor Seal (Phoca Vitulina) ... and PCB-induced Alterations of Protein Tyrosine Kinase and Cytokine Gene Transcription in Harbor Seal (Phoca Vitulina) PBMC," ...
  https://www.hindawi.com/journals/jir/2005/786243/cta/
*  Partial purification and characterization of the lck protein-tyrosine kinase from bovine thymus | Biochemical Journal
Partial purification and characterization of the lck protein-tyrosine kinase from bovine thymus. Q Wang, P R Srinivas, M L ... Fractionation of this protein-tyrosine kinase activity by chromatography on DEAE-cellulose yields a major diffuse peak of ... Partial purification and characterization of the lck protein-tyrosine kinase from bovine thymus ... Partial purification and characterization of the lck protein-tyrosine kinase from bovine thymus ...
  http://www.biochemj.org/content/279/2/567