*  IRF9 / ISGF3G antibody | acris-antibodies.com
Irf9 gRNA vector 1 in pCas-Guide vector- KN308431G2, Irf9 gRNA vector 2 in pCas-Guide vector- KN308431D, donor vector… ... Background of IRF9 / ISGF3G antibody. Kit Component:. - KN308431G1, Irf9 gRNA vector 1 in pCas-Guide vector. - KN308431G2, Irf9 ... Alternative names for IRF9 / ISGF3G antibody. Interferon regulatory factor 9, IRF-9, ISGF3 p48, ISGF-3 gamma, Transcriptional ... Lenti ORF particles, IRF9 (Myc-DDK tagged) - Human interferon regulatory factor 9 (IRF9) , 200 uL, ,10^7 TU/mL. Not available. ...
  https://www.acris-antibodies.com/target/irf9-antibody-isgf3g-antibody.htm
*  STAT2 gene - Genetics Home Reference
The phosphorylated STATs dimerize, associate with IRF9/ISGF3G to form a complex termed ISGF3 transcription factor, that enters ... In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G ...
  https://ghr.nlm.nih.gov/gene/STAT2
*  Anti-Interferon regulatory factor 9 antibody [EPR3939] (ab109309)
The phosphorylated STATs dimerize, associate with IRF9/ISGF3G to form a complex termed ISGF3 transcription factor, that enters ...
  http://www.abcam.com/interferon-regulatory-factor-9-antibody-epr3939-ab109309.html
*  Anti-Interferon regulatory factor 9 antibody (ab51639)
The phosphorylated STATs dimerize, associate with IRF9/ISGF3G to form a complex termed ISGF3 transcription factor, that enters ... Synthetic peptide of human ISGF3G that is within the following sequence: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK . ...
  http://www.abcam.com/interferon-regulatory-factor-9-antibody-ab51639.html
*  Anti-STAT1 alpha antibody [EPYR2154]| KO Validated
The phosphorylated STATs dimerize, associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters ...
  http://www.abcam.com/stat1-alpha-antibody-epyr2154-ab92506.html
*  Anti-STAT1 antibody [SM1] (ab3987) | Abcam
The phosphorylated STATs dimerize, associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters ...
  http://www.abcam.com/stat1-antibody-sm1-ab3987.html
*  STAT1 - Wikipedia
STAT molecules form dimers and bind to ISGF3G/IRF-9, which is Interferon stimulated gene factor 3 complex with Interferon ... "IRF9 Gene - GeneCards , IRF9 Protein , IRF9 Antibody". www.genecards.org. Retrieved 2017-06-01. "STAT1 - Signal transducer and ... ISGF3G Interleukin 27 receptor, alpha subunit, MCM5, Mammalian target of rapamycin, PIAS1, PRKCD, PTK2, Protein kinase R, STAT2 ...
  https://en.wikipedia.org/wiki/STAT1
*  Irf1 protein (mouse) - STRING interaction network
The phosphorylated STATs dimerize and associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that ... The phosphorylated STATs dimerize and associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that ... The phosphorylated STATs dimerize and associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that ... The phosphorylated STATs dimerize, associate with IRF9/ISGF3G to form a complex termed ISGF3 transcription factor, that enters ...
  https://string-db.org/network/10090.ENSMUSP00000019043
*  Anti-STAT2 Antibody
The phosphorylated STATs dimerize, associate with IRF9/ISGF3G to form a complex termed ISGF3 transcription factor, that enters ...
  https://www.bosterbio.com/anti-stat2-antibody-pa1509.html
*  STAT1 (phospho Y701)抗体|Abcam中国|Anti-STAT1 (phospho Y701)抗体
The phosphorylated STATs dimerize, associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters ...
  http://www.abcam.cn/stat1-phospho-y701-antibody-ab30645.html
*  Recombinant Human STAT1 protein (ab82610) | アブカム
The phosphorylated STATs dimerize, associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters ...
  http://www.abcam.co.jp/recombinant-human-stat1-protein-ab82610.html
*  Anti-STAT1 alpha 抗体 [EPR4407] (ab109320)
The phosphorylated STATs dimerize, associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters ...
  http://www.abcam.co.jp/stat1-alpha-antibody-epr4407-ab109320.html
*  STAT1抗体|Abcam中国|Anti-STAT1抗体(ab31369)
The phosphorylated STATs dimerize, associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters ...
  http://www.abcam.cn/stat1-antibody-ab31369.html
*  STAT1 alpha抗体| Abcam中国
The phosphorylated STATs dimerize, associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters ...
  http://www.abcam.cn/stat1-alpha-antibody-ab2071.html
*  Signal transducer and activator of transcription 1-alpha/beta
The phosphorylated STATs dimerize and associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that ...
  https://pharos.nih.gov/idg/targets/P42224
*  Anti-STAT1 Antibody
The phosphorylated STATs dimerize and associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that ...
  https://www.bosterbio.com/anti-stat1-antibody-pa1075.html
*  IRF9 - Wikipedia
Interferon regulatory factor 9 is a protein that in humans is encoded by the IRF9 gene, previously known as ISGF3G. IRF9 has ... ISGF3G protein, human at the US National Library of Medicine Medical Subject Headings (MeSH) IRF9 human gene location in the ... "Entrez Gene: ISGF3G interferon-stimulated transcription factor 3, gamma 48kDa". Horvath, C M; Stark G R; Kerr I M; Darnell J E ... IRF9 human gene details in the UCSC Genome Browser. This article incorporates text from the United States National Library of ...
  https://en.wikipedia.org/wiki/IRF9
*  Browse our STAT2 ELISA Kits
PKV VP3 associated with STAT2 and IRF9 (show IRF9 ELISA Kits), and interfered with the formation of the STAT2-IRF9 (show IRF9 ... In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G ... Activation of STAT2/IRF9 (show IRF9 ELISA Kits) induces a prolonged ISGF3 (show IRF9 ELISA Kits)-like transcriptome and ... show IRF9 ELISA Kits); and 2) signaling pathways not involving STAT1 (show STAT1 ELISA Kits), STAT2, or IRF9 (show IRF9 ELISA ...
  http://www.antibodies-online.com/jak-stat-signaling-pathway-6/stat2-elisa-kit-8476/
*  anti-STAT2 antibody | GeneTex
In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G ...
  http://www.genetex.com/STAT2-antibody-GTX50661.html