*  IRF9 / ISGF3G antibody | acris-antibodies.com
Irf9 gRNA vector 1 in pCas-Guide vector- KN308431G2, Irf9 gRNA vector 2 in pCas-Guide vector- KN308431D, donor vector… ... Background of IRF9 / ISGF3G antibody. Kit Component:. - KN308431G1, Irf9 gRNA vector 1 in pCas-Guide vector. - KN308431G2, Irf9 ... Alternative names for IRF9 / ISGF3G antibody. Interferon regulatory factor 9, IRF-9, ISGF3 p48, ISGF-3 gamma, Transcriptional ... Lenti ORF particles, IRF9 (Myc-DDK tagged) - Human interferon regulatory factor 9 (IRF9) , 200 uL, ,10^7 TU/mL. Not available. ...
  https://www.acris-antibodies.com/target/irf9-antibody-isgf3g-antibody.htm
*  STAT2 gene - Genetics Home Reference
The phosphorylated STATs dimerize, associate with IRF9/ISGF3G to form a complex termed ISGF3 transcription factor, that enters ... In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G ...
  https://ghr.nlm.nih.gov/gene/STAT2
*  Anti-Interferon regulatory factor 9 antibody [EPR3939] (ab109309)
The phosphorylated STATs dimerize, associate with IRF9/ISGF3G to form a complex termed ISGF3 transcription factor, that enters ...
  http://www.abcam.com/interferon-regulatory-factor-9-antibody-epr3939-ab109309.html
*  Anti-Interferon regulatory factor 9 antibody (ab51639)
The phosphorylated STATs dimerize, associate with IRF9/ISGF3G to form a complex termed ISGF3 transcription factor, that enters ... Synthetic peptide of human ISGF3G that is within the following sequence: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK . ...
  http://www.abcam.com/interferon-regulatory-factor-9-antibody-ab51639.html
*  Anti-STAT1 alpha antibody [EPYR2154]| KO Validated
The phosphorylated STATs dimerize, associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters ...
  http://www.abcam.com/stat1-alpha-antibody-epyr2154-ab92506.html
*  Anti-STAT1 antibody [SM1] (ab3987) | Abcam
The phosphorylated STATs dimerize, associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters ...
  http://www.abcam.com/stat1-antibody-sm1-ab3987.html
*  Irf1 protein (mouse) - STRING interaction network
The phosphorylated STATs dimerize and associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that ... The phosphorylated STATs dimerize and associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that ... The phosphorylated STATs dimerize and associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that ... The phosphorylated STATs dimerize, associate with IRF9/ISGF3G to form a complex termed ISGF3 transcription factor, that enters ...
  https://string-db.org/network/10090.ENSMUSP00000019043
*  Anti-STAT2 Antibody
The phosphorylated STATs dimerize, associate with IRF9/ISGF3G to form a complex termed ISGF3 transcription factor, that enters ...
  https://www.bosterbio.com/anti-stat2-antibody-pa1509.html
*  Chromosome 14 | Cancer Genetics Web
IRF9. 14q11.2. p48, IRF-9, ISGF3, ISGF3G. -Bladder Cancer. -Liver Cancer. -Melanoma. -Skin Cancer. ...
  http://www.cancer-genetics.org/clinkc14.htm
*  STAT1 (phospho Y701)抗体|Abcam中国|Anti-STAT1 (phospho Y701)抗体
The phosphorylated STATs dimerize, associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters ...
  http://www.abcam.cn/stat1-phospho-y701-antibody-ab30645.html
*  Recombinant Human STAT1 protein (ab82610) | アブカム
The phosphorylated STATs dimerize, associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters ...
  http://www.abcam.co.jp/recombinant-human-stat1-protein-ab82610.html
*  Anti-STAT1 alpha 抗体 [EPR4407] (ab109320)
The phosphorylated STATs dimerize, associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters ...
  http://www.abcam.co.jp/stat1-alpha-antibody-epr4407-ab109320.html
*  STAT1抗体|Abcam中国|Anti-STAT1抗体(ab31369)
The phosphorylated STATs dimerize, associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters ...
  http://www.abcam.cn/stat1-antibody-ab31369.html
*  STAT1 alpha抗体| Abcam中国
The phosphorylated STATs dimerize, associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters ...
  http://www.abcam.cn/stat1-alpha-antibody-ab2071.html
*  Signal transducer and activator of transcription 1-alpha/beta
The phosphorylated STATs dimerize and associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that ...
  https://pharos.nih.gov/idg/targets/P42224
*  Anti-STAT1 Antibody
The phosphorylated STATs dimerize and associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that ...
  https://www.bosterbio.com/anti-stat1-antibody-pa1075.html
*  Browse our STAT2 ELISA Kits
PKV VP3 associated with STAT2 and IRF9 (show IRF9 ELISA Kits), and interfered with the formation of the STAT2-IRF9 (show IRF9 ... In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G ... Activation of STAT2/IRF9 (show IRF9 ELISA Kits) induces a prolonged ISGF3 (show IRF9 ELISA Kits)-like transcriptome and ... show IRF9 ELISA Kits); and 2) signaling pathways not involving STAT1 (show STAT1 ELISA Kits), STAT2, or IRF9 (show IRF9 ELISA ...
  http://www.antibodies-online.com/jak-stat-signaling-pathway-6/stat2-elisa-kit-8476/
*  anti-STAT2 antibody | GeneTex
In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G ...
  http://www.genetex.com/STAT2-antibody-GTX50661.html