*  PLOS ONE: Fine Tuning of Globin Gene Expression by DNA Methylation
In addition, our findings provide a mechanism for understanding the high levels of γ-globin transcription seen in patients with ... demonstrate that DNA methylation serves as an elegant in vivo fine-tuning device for selecting appropriate genes in the globin ... Expression patterns in the globin gene cluster are subject to developmental regulation in vivo. While the γA and γG genes are ... Hereditary Persistence of Fetal Hemoglobin, and help explain why 5azaC and butyrate compounds stimulate γ-globin expression in ...
*  Regulation of human embryonic globin genes zeta 2 and epsilon in stably transformed mouse erythroleukemia cells. - Radcliffe...
... cast doubt on the possibility that these sequences play a major role in the developmental repression of the embryonic globin ... Previous work has suggested that the promoter regions of the human embryonic zeta 2 and epsilon globin genes contain negative ... Regulation of human embryonic globin genes zeta 2 and epsilon in stably transformed mouse erythroleukemia cells. ... Previous work has suggested that the promoter regions of the human embryonic zeta 2 and epsilon globin genes contain negative ...
*  "Induction of endogenous γ-globin gene expression with decoy oligonucleotide targeting . . ." by Xiaoxin S. Xu, Xin Hong et al.
The human γ-globin genes (both Aγ and Gγ-globin genes) carry three Oct-1 transcription factor consensus sequences within their ... Increasing the expression of the γ-globin gene has great benefits in reducing complications associated with these diseases. The ... We have studied the possibility of inducing γ-globin gene expression using decoy oligonucleotides that target the Oct-1 ... significant increases in the level of the γ-globin mRNA were observed. The results of our western blots further demonstrated ...
*  MicroRNA-96 directly inhibits γ-Globin expression in human erythropoiesis - Zurich Open Repository and Archive
The overexpression of microRNA-96 in human ex vivo erythropoiesis decreased γ-globin expression by 50%, whereas the knock-down ... The overexpression of microRNA-96 in human ex vivo erythropoiesis decreased γ-globin expression by 50%, whereas the knock-down ... Based on these results we conclude that microRNA-96 directly suppresses γ-globin expression and thus contributes to HbF ... Based on these results we conclude that microRNA-96 directly suppresses γ-globin expression and thus contributes to HbF ...
*  Unmask Blood RNA for Gene Expression Profiling ( GLOBINclear-Human Globin mRNA Removal ...)
Depletes alpha and beta globin mRNA from blood total RNA with a simple magnetic bead procedure (no enzymatic treatments) ... GLOBINclear-Human Globin mRNA Removal Kit Depletes alpha and beta globin mRNA from blood total RNA with a simple magnetic bead ... Globin Transcript Removal Ambion's GLOBINclear-Human Kit is designed to rapidly deplete alpha and beta globin mRNA from total ... GLOBINclear-Human Globin mRNA Removal Kit Depletes alpha and beta globin mRNA from blood total RNA with a simple magnetic bead ...
*  Molecular mechanisms of globin gene regulation and disregulat...
Human globin genes are expressed in tissue and developmental stage specific manners. Variou ... Molecular mechanisms of globin gene regulation and disregulation].: ... Molecular mechanisms of globin gene regulation and disregulation].. Authors * Fukumaki, Y Type. Published Article. Journal. ... Human globin genes are expressed in tissue and developmental stage specific manners. Various experiments including expression ...
*  Anthropogenetical Analysis of Abnormal Human -globin Gene Cluster Arrangement on Chromosome 16* - pdf descargar
... globin Gene Cluster Arrangement on Chromosome 16*. . Biblioteca virtual para leer y descargar libros, documentos, trabajos y ... The analysis of -globin genes in the offspring of our probands showed the triplicated -globin genes in two persons. We also ... An earlier study of human globin gene polymorphism in two Adriatic islands of Olib and Silba showed an abnormal arrangement of ... We did not find any deleted -globin genes. We determined the kinship relationship between the two probands, one with deleted ...
*  Erythroid-specific expression of human CD59 and transfer to vascular endothelial cells. - Oxford Neuroscience
Animals, Antigens, CD, CD59 Antigens, Complement Inactivator Proteins, Gene Expression, Gene Transfer Techniques, Globins, ...
*  Globin - Wikipedia
Eight globins are known to occur in vertebrates: androglobin, cytoglobin, globin E, globin X, globin Y, hemoglobin, myoglobin ... The globin fold is found in its namesake globin families as well as in phycocyanins. The globin fold was thus the first protein ... Globin E: a globin responsible for storing and delivering oxygen to the retina in birds Globin-coupled sensors: chimeric, with ... single-domain globins, and two types of chimeric globins, flavohaemoglobins and globin-coupled sensors. Bacteria have all three ...
*  Jörg Bungert, Ph.D.
The work in our laboratory focuses on analyzing the regulation of globin gene expression in red blood cells. The globin genes ... We use a combination of genetic and biochemical approaches to analyze the structure and function of the human b-globin locus ... The LCR, which is composed of several sub-regions revealing high sensitivity to nucleases in erythroid cells enhances globin ... where he studied the developmental regulation of the human b-globin genes. Dr. Bungert joined the faculty at the University of ...
*  "Proximity among distant regulatory elements at the beta-globin locus r" by Christopher R. Vakoc, Danielle L. Letting et al.
Here, we examined the mechanism for DNA looping at the beta-globin locus. By using chromosome conformation capture (3C), we ... GATA-1 occupies the beta-major globin promoter normally in fetal liver erythroblasts from mice lacking the LCR, suggesting that ... Kinetic studies reveal that GATA-1-induced loop formation correlates with the onset of beta-globin transcription and occurs ... transcription factor GATA-1 and its cofactor FOG-1 are required for the physical interaction between the beta-globin locus ...
*  HBE1 - Wikipedia
The epsilon globin gene (HBE) is normally expressed in the embryonic yolk sac: two epsilon chains together with two zeta chains ... Tuan D, Solomon W, Li Q, London IM (1985). "The "beta-like-globin" gene domain in human erythroid cells". Proc. Natl. Acad. Sci ... The five beta-like globin genes are found within a 45 kb cluster on chromosome 11 in the following order: 5' - epsilon - gamma- ... 1977). "Human beta-globin messenger RNA. I. Nucleotide sequences derived from complementary RNA". J. Biol. Chem. 252 (14): 5019 ...
*  globin - Wiktionary
biochemistry) Any globular protein that incorporates a globin fold. *(biochemistry) One of several polypeptides that are the ... Retrieved from "https://en.wiktionary.org/w/index.php?title=globin&oldid=48058080" ...
*  Globin like (cd01067) | InterPro | EMBL-EBI
Globin_like (cd01067). Accession cd01067 Integration. RsbS co-antagonist protein RsbRA N-terminal domain (IPR014792) Member ...
*  Globin - Medical Dictionary / Glossary | Medindia
Globin' - The protein component of hemoglobi, is clearly explained in Medindia s glossary of medical terms ... Globin - Glossary. Written & Compiled by Medindia Content Team. Medically Reviewed by The Medindia Medical Review Team on May ...
*  Globin - Lampetra fluviatilis (European river lamprey)
Belongs to the globin family.PROSITE-ProRule annotation. ,p>Manual validated information which has been generated by the ... sp,P02207,GLB_LAMFL Globin OS=Lampetra fluviatilis OX=7748 PE=1 SV=2 ...
*  Globin-F1 - Eptatretus burgeri (Inshore hagfish)
Belongs to the globin family.PROSITE-ProRule annotation. ,p>Manual validated information which has been generated by the ... sp,Q7SID0,GLBF1_EPTBU Globin-F1 OS=Eptatretus burgeri PE=1 SV=1 PIIDQGPLPTLTDGDKKAINKIWPKIYKEYEQYSLNILLRFLKCFPQAQASFPKFSTKKS ...
*  PPT - Globins PowerPoint Presentation - ID:1348492
Globins. Lecture 10/01/2009. The Backbone structure of Myoglobin. 2. Myoglobin: 44 x 44 x 25 Å single subunit 153 amino acid ... Globins & Enzyme Catalysis -Globins & enzyme catalysis. 10/06/2009. the bohr effect. higher ph i.e. lower [h + ] promotes ... EVOLUTION OF GLOBINS -. evolution of globins evolution of visual pigments and related molecules. evolution of gene clusters. ... Globins & Enzyme Catalysis -. 10/06/2009. the bohr effect. higher ph i.e. lower [h + ] promotes tighter binding of oxygen to ...
*  beta-Globins - beta Globin Summary Report | CureHunter
They include epsilon-globin, gamma-globin, delta-globin and beta-globin. There is also a pseudogene of beta (theta-beta) in the ... Adult HEMOGLOBIN is comprised of two ALPHA-GLOBIN chains and two beta-globin chains. ... Members of the beta-globin family. In humans, they are encoded in a gene cluster on CHROMOSOME 11. ... beta Globin; Non-alpha Globin Chain, Unspecified; Non alpha Globin Chain, Unspecified; beta Globins; beta-Globin ...
*  Extracellular globin-3 precursor - Lumbricus terrestris (Common earthworm)
Extracellular globin-3Add BLAST. 153. Amino acid modifications. Feature key. Position(s). DescriptionActions. Graphical view. ... "Two globin strains in the giant annelid extracellular haemoglobins.". Gotoh T., Shishikura F., Snow J.W., Ereifej K.I., ... Belongs to the globin family.PROSITE-ProRule annotation. ,p>Manual validated information which has been generated by the ... sp,P11069,GLB3_LUMTE Extracellular globin-3 OS=Lumbricus terrestris OX=6398 PE=1 SV=3 ...
*  RCSB PDB - Protein Feature View - Globin-F1 - Q7SID0 (GLBF1 EPTBU)
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
*  Human Beta-globin Control Primer Set
... Takara's Human Beta-globin Control Primer Set contains a set of PCR primers that ... The Human Beta-globin Control Primer Set may be used as a experimental control during protocols such as PCR. Primer Sequences. ... Beta-globin makes up about half of the human hemoglobin tertrameric protein; in the normal human adult, the hemoglobin tetramer ... Products , PCR , Pathogen_Detection_and_Screening_Kits , Human_Pathogen_Detection , Human_Beta-globin_Control_Primer_Set. ...
*  WikiGenes - GATA1 - GATA binding protein 1 (globin...
In vivo footprinting of the human alpha-globin locus upstream regulatory element by guanine and adenine ligation-mediated ...
*  Search of: 'methemoglobinemia, beta-globin type' OR 'methemoglobinemia' - List Results - ClinicalTrials.gov
Incidence of methemoglobinemia in patients with hematologic malignancy or aplastic anemia who received dapsone prophylaxis through a retrospective chart review encompassing the last 15 ...