*  Characterization of canine pericardial fluid endothelin-1 leve...
... extremely high concentrations of endothelin-1 (ET-1) were detected in the pericardi ... Characterization of canine pericardial fluid endothelin-1 levels.: Recently, ... Recently, extremely high concentrations of endothelin-1 (ET-1) were detected in the pericardial fluid of patients undergoing ... 31 Suppl 1 Identifiers. PMID: 9595495 Source. Medline License. Unknown Abstract. ...
*  Circulation Editors' Picks | Circulation
Approximately 50% of the patients enrolled in the PHIRST study were on background therapy with the endothelin receptor ... Currently approved treatment options include prostanoids, endothelin receptor antagonists, and a phosphodiesterase type-5 ... suppression of endothelin-converting enzyme 1 (ECE-1). ECE-1 converts the inactive precursor molecule big endothelin-1 into the ... and genetic deletion of E2F2 in mice was associated with both exaggerated vessel contractility in response to big endothelin-1 ...
*  Better understanding of blood vessel constrictor needed to harness its power for patients
RxPG] To harness endothelin-1's power to constrict blood vessels and help patients manage high blood pressure or heart failure ... Ergul, an expert on endothelin-1's role in diabetes, believes the unexpected results are better explained by poorly understood ... Endothelin-1 receptors are known to interact: one way blood vessels keep a healthy tone, for example, is that a and b receptors ... Endothelin-1 receptors on the kidneys are a player as well, helping wring out excess water and salt. There is a delicate ...
*  Vulnerable Plaque | Annals of Internal Medicine | American College of Physicians
However, evidence for endothelin-1 as an important determinant of plaque vulnerability and rupture is yet to come. With the ... If endothelin-1 antagonists do reduce coronary events, a central role for endothelin in promoting plaque instability could then ... Doherty and McMillen point out the several proatherogenic properties of endothelin-1. The work by Zeiher and coworkers (1) ... suggests that endothelin-1 is involved in the pathogenesis of acute coronary syndromes. ...
*  Nitric Oxide Inhibition of Endothelin-1 Release in the Vasculature | Hypertension
Interactions of endothelins and EDRF in bovine native endothelial cells: selective effects of endothelin-3. Am J Physiol. 1992; ... Effect of clazosentan, a selective endothelin A receptor antagonist, and tezosentan, a dual endothelin A/B antagonist, on ... Altered role of smooth muscle endothelin receptors in coronary endothelin-1 and alpha1-adrenoceptor-mediated vasoconstriction ... Role of endogenous endothelin in the regulation of basal coronary tone in the rat. J Physiol. 1998;511(Pt 2):549-557. ...
*  Intravenous endothelin-1 and ventilatory sensitivity to hypoxia in humans. - Physiology, Anatomy and Genetics
Plasma ET-1 levels and an index of ventilation were measured regularly. Hypoxia caused a rise in plasma ET-1 in the control ... Hypoxia also caused the index of ventilation to increase in both protocols, and this increase was greater in the ET-1 protocol ... They received a continuous infusion of ET-1 during the ET-1 protocol and an infusion of saline during the control protocol. ... These results are consistent with the hypothesis that ET-1 plays a role in controlling the ventilatory response to hypoxia in ...
*  The Association of Red Blood Cell Counts with Endothelin-1 in African and Caucasian Women
... dc.contributor.author. Schutte, ... The Association of Red Blood Cell Counts with Endothelin-1 in African and Caucasian Women. Clinical And Experimental ... The literature shows an increase in endothelin-1 with increased levels of erythrocytes. There are also indications that ... In this study, the association of erythrocytes and endothelin-1 in women of different ethnicities was investigated. Blood ...
*  Endothelin-1 receptor - DrugBank
Endothelin-1 receptor. P25101. Details. Drug Relations. Drug Relations. DrugBank ID. Name. Drug group. Pharmacological action? ... Endothelin-1 receptor. Kind. protein. Organism. Human. Polypeptides. Name. UniProt ID. ...
*  Big Endothelin-1 (1-38), human
Endothelins are endothelium-derived vasoconstrictor peptides.; CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1-15 ... Big Endothelin-1 (1-38) is precursor of endothelin 1. Big endothelin-1 is cleaved to yield endothelin-1 via the activity of an ... endothelin-converting enzyme (ECE). Big Endothelin-1 can be hydrolyzed by chymase to generate endothelin 1 (1-21) in vitro. ... Big Endothelin-1 (1-38) is precursor of endothelin 1. Big endothelin-1 is cleaved to yield endothelin-1 via the activity of an ...
*  Endothelin 1 - Wikipedia
Endothelin 1 (ET-1), also known as preproendothelin-1 (PPET1), is a potent vasoconstrictor that in humans is encoded by the ... Endothelin-1 receptor antagonists (Bosentan) are used in the treatment of pulmonary hypertension. Inhibition of these receptors ... Davenport AP, Hyndman KA, Dhaun N, Southan C, Kohan DE, Pollock JS, Pollock DM, Webb DJ, Maguire JJ (April 2016). "Endothelin ... Beghetti M, Black SM, Fineman JR (2005). "Endothelin-1 in congenital heart disease". Pediatr. Res. 57 (5 Pt 2): 16R-20R. doi: ...
*  Plasma immunoreactive endothelin-1 in experimental malignant hypertension. | Hypertension
Plasma immunoreactive endothelin-1 in experimental malignant hypertension.. M Kohno, K Murakawa, T Horio, K Yokokawa, K ... Plasma immunoreactive endothelin-1 in experimental malignant hypertension.. M Kohno, K Murakawa, T Horio, K Yokokawa, K ... Plasma immunoreactive endothelin-1 in experimental malignant hypertension.. M Kohno, K Murakawa, T Horio, K Yokokawa, K ... We measured plasma concentrations of immunoreactive endothelin-1 (irET-1) in the prehypertensive and hypertensive phases in ...
*  Big Endothelin-1 Detection: ELISAs and Antibodies
... and endothelin-3 (ET-3). All three isoforms are encoded by a 38-amino-acid precursor known as big endothelin. Endothelins are ... Endothelins are among the most potent vasoconstrictor proteins known. Overexpression of endothelins contributes to hypertension ... Anti-Human Big Endothelin-1 (22-38) Rabbit IgG Affinity Purify 5 ug $121.00 ... Anti-Rat Big Endothelin-1 (22-38) Rabbit IgG Affinity Purify 50 ug $529.00 ...
*  Anti-Endothelin 1 antibody [TR.ET.48.5] (ab2786) | Abcam
Mouse monoclonal Endothelin 1 antibody [TR.ET.48.5] validated for WB, IP, ELISA, IHC, RIA, Flow Cyt, Inhibition, ICC/IF and ... Anti-Endothelin 1 antibody [TR.ET.48.5] (ab2786) at 1/500 dilution + PC12 cell lysate at 25 µg. Predicted band size : 24 kDa. ... Nur77 attenuates endothelin-1 expression via downregulation of NF-?B and p38 MAPK in A549 cells and in an ARDS rat model.. Am J ... ab2786 labelling Endothelin 1 (green) in the secretion of HeLa cells (right) compared with a negative control (left) by ...
*  Mechanisms of Big Endothelin-1-Induced Diuresis and Natriuresis | Hypertension
Use of the endothelin antagonists BQ-123 and PD 142893 to reveal three endothelin receptors mediating smooth muscle contraction ... Mechanisms of Big Endothelin-1-Induced Diuresis and Natriuresis. Role of ETB Receptors. Aaron Hoffman, Zaid A. Abassi, Sergey ... Endothelin, a peptide inhibitor of Na+-K+-ATPase in intact renal tubular epithelial cells. Am J Physiol. 1989;257:C1101-C1107. ... Analysis of responses to endothelins in isolated porcine blood vessels by using a novel endothelin antagonist, BQ-153. Life Sci ...
*  Antiapoptotic Effect of Endothelin-1 in Rat Cardiomyocytes In Vitro | Hypertension
Antiapoptotic Effect of Endothelin-1 in Rat Cardiomyocytes In Vitro. Yukiyo Ogata, Masafumi Takahashi, Shuichi Ueno, Koichi ... Endothelin-1 (ET-1), a family of 21-amino acid peptides, is 1 of the most potent hypertrophic stimuli for cardiac myocytes.15, ... Antiapoptotic Effect of Endothelin-1 in Rat Cardiomyocytes In Vitro. Yukiyo Ogata, Masafumi Takahashi, Shuichi Ueno, Koichi ... Antiapoptotic Effect of Endothelin-1 in Rat Cardiomyocytes In Vitro. Yukiyo Ogata, Masafumi Takahashi, Shuichi Ueno, Koichi ...
*  Pathophysiological Roles of Endothelin-1 in Dahl Salt-Sensitive Hypertension | Hypertension
receptors, endothelin. Endothelin-1 (ET-1) is known to have not only potent vasoconstrictive action but also mitogenic action ... Role of endothelin receptor subtypes in the in vivo regulation of renal function. Am J Physiol. 1995;268:F455-F460. ... Pathophysiological Roles of Endothelin-1 in Dahl Salt-Sensitive Hypertension. Takanori Ikeda, Hisashi Ohta, Megumu Okada, ... J-104132 is a potent mixed endothelin A and B (ETA/ETB) receptor antagonist with a long duration of activity14 and was used to ...
*  Role of Endogenous Endothelin-1 in Experimental Renal Hypertension in Dogs | Circulation
This led for the search for antagonists of endogenous endothelin and, more precisely, for an antagonist of endothelin-1 ... How can these normal plasma endothelin levels in hypertensive dogs be reconciled with a pathophysiological role of endothelin ... Pathophysiological role of endothelin revealed by the first orally active endothelin receptor antagonist. Nature. 1993;365:759- ... Effects of different endothelin receptor antagonists and of the novel non-peptide antagonist R0 46-2005 on endothelin levels in ...
*  Endothelin-1 as a Potential Trigger of Migraine Aura - Full Text View - ClinicalTrials.gov
Endothelin-1 as a Potential Trigger of Migraine Aura. The safety and scientific validity of this study is the responsibility of ... Current animal evidence indicates that infusion of endothelin-1 (ET-1), a naturally occurring signaling molecule released from ... Investigations of the Endogenous Vasoconstrictor and Neuromodulator Peptide Endothelin-1 as a Potential Trigger of Migraine ... In this project the investigators aim to study the effects of ET-1 on the human brain, to investigate aura-inducing effects of ...
*  Role Of Endothelin-1 and Nitric Oxide Bioavailability in Transplant-Related Vascular Injury | Circulation
Endothelin Receptor Expression. Thoracic aortic ETA Rc protein expression was significantly (P=0.004) increased after CyA ... Figure 3. Endothelin-1 (ET-1) plasma levels after 2 weeks of treatment. Rapamycin (SRL) treatment significantly reduces ET-1 ... Effects of cyclosporin A on the synthesis, excretion, and metabolism of endothelin in the rat. Hypertension. 1996; 27: 1140- ... Role Of Endothelin-1 and Nitric Oxide Bioavailability in Transplant-Related Vascular Injury. Comparative Effects of Rapamycin ...
*  Ala(1,3,11,15)- endothelin 1 Summary Report | CureHunter
... endothelin 1: alanyl residues substituted for cysteinyl in endothelin-1; RN given refers to (all-L)-isomer; has been used as a ... endothelin 1, Ala(1,3,11,15)-; (Ala-1,3,11,15)ET-1; 1,3,11,15-Ala-endothelin-1; 1,3,11,15-alanine-endothelin 1; 4-Ala- ... alanyl residues substituted for cysteinyl in endothelin-1; RN given refers to (all-L)-isomer; has been used as a radioligand, ... endothelin 1. Subscribe to New Research on Ala(1,3,11,15)- endothelin 1 ...
*  Prospective Study on Plasma Pro-endothelin-1 in Predicting Bronchopulmonary Dysplasia - Full Text View - ClinicalTrials.gov
Prospective Study on Plasma Pro-endothelin-1 in Predicting Bronchopulmonary Dysplasia. This study has been completed. ... Comparing pro-endothelin-1 with established clinical indices of bronchopulmonary dysplasia (BPD). Hypothesis: Pulmonary- ... Serial quantitative measurements of plasma pro-endothelin-1 concentrations in very preterm infants. ... vascular remodeling in infants developing BPD is directly related to circulating pro-endothelin-1, which therefore serves as ...
*  Air Pollution-Induced Vascular Dysfunction: Potential Role of Endothelin-1 (ET-1) System | SpringerLink
Luscher, T. F., & Barton, M. (2000). Endothelins and endothelin receptor antagonists: Therapeutic considerations for a novel ... 1995). Evidence for endothelin-1-mediated vasoconstriction in severe chronic heart failure. Lancet, 346, 732-736.PubMedCrossRef ... 2014). Endothelin-1 signalling controls early embryonic heart rate in vitro and in vivo. Acta Physiologica, 210, 369-380.PubMed ... Levin, E. R. (1995). Endothelins. New England Journal of Medicine, 333, 356-363.PubMedCrossRefGoogle Scholar ...
*  Second trimester amniotic fluid endothelin-1 concentrations and subsequent development of intrauterine growth restriction.
ET-1) concentrations in the second trimester amniotic fluid and compare these values in women who developed intrauterine growth ... The purpose of this prospective study was to record endothelin-1 ( ... Endothelin-1 / analysis, metabolism*. Female. Fetal Growth Retardation / metabolism*. Humans. Pregnancy. Pregnancy Trimester, ... OBJECTIVE: The purpose of this prospective study was to record endothelin-1 (ET-1) concentrations in the second trimester ...
*  Endothelin-1 Increases Glomerular Permeability and Inflammation Independent of Blood Pressure in the Rat | Hypertension
Endothelin/Endothelium. Endothelin-1 Increases Glomerular Permeability and Inflammation Independent of Blood Pressure in the ... Role of endothelin receptor subtypes in the in vivo regulation of renal function. Am J Physiol Renal Physiol. 1995; 268: F455- ... Endothelin A receptor blockade reduces diabetic renal injury via an anti-inflammatory mechanism. J Am Soc Nephrol. 2007; 18: ... Novel ligands BQ123 and BQ3020 characterize endothelin receptor subtypes ETA and ETB in human kidney. Kidney Int. 1993; 44: 36- ...