Loading...
*  Caspase 3 - Wikipedia
"Involvement of caspases in proteolytic cleavage of Alzheimer's amyloid-beta precursor protein and amyloidogenic A beta peptide ... bond cleavage of a protein sequence to the carboxy-terminal side of an aspartic acid when it is part of a particular 4-amino ... It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal ... In vitro, caspase-3 has been found to prefer the peptide sequence DEVDG (Asp-Glu-Val-Asp-Gly) with cleavage occurring on the ...
  https://en.wikipedia.org/wiki/Caspase_3
*  Eckard Weber, San Diego US - Patent applications
... fragment includes the carboxyterminal amino acid sequence of amyloid precursor protein and amyloid-beta amino acid sequence. ... cleavage of amyloid precursor protein to produce an approximately 17 kilodalton carboxy-terminal fragment of amyloid precursor ... cleavage of amyloid precursor protein to produce the approximately 17 kilodalton carboxy-terminal fragment of amyloid precursor ... Method of Inducing Cleavage of Amyloid Precursor Protein to Form a Novel Fragment - The present invention provides a method of ...
  http://www.patentsencyclopedia.com/inventor/eckard-weber-san-diego-us-1/
*  Beta-Amyloid Precursor Protein, CTF-31 | rPeptide
The 31-amino acid peptide results from the proteolytic cleavage of the C- terminus of beta-amyloid precursor protein (APP) at ... Sequence A A V T P E E R H L S K M Q Q N G Y E N P T Y K F F E Q M Q N ... Beta-Amyloid Precursor Protein, CTF-31. ORDER ONLINE • CALL 866.753.0747 • FAX 678.753.0746 ... Beta Amyloid Peptides*Beta-Amyloid Antibodies. *Beta-Amyloid Peptides, Human, Native and Mutant, Recombinant ...
  https://www.rpeptide.com/products/proteins/amyloid-precursor-protein/a-1201-1
*  Secretases related to alzheimer's dementia - Patent # 6245884 - PatentGenius
... secretase that produce the A.beta. peptides found in the plaques of Alzheimer Dementia (AD) patients. The invention also ... "Evidence that the 42-and 40-amino acid forms of amyloid .beta. protein are generated from the .beta.-amyloid precursor protein ... In addition to the A.beta. peptides, proteolytic cleavage of another specific amino acid sequence within the APP proteins is ... That amino acid sequence lies within theA.beta. peptide amino acid sequence of the APP proteins. Like the .beta.-secretase and ...
  http://www.patentgenius.com/patent/6245884.html
*  Amyloid precursor protein - Wikipedia
Ohsawa I, Takamura C, Kohsaka S (Mar 2001). "Fibulin-1 binds the amino-terminal head of beta-amyloid precursor protein and ... Cleavage by gamma secretase within the membrane-spanning domain after beta-secretase cleavage generates the amyloid-beta ... short peptide 15-amino-acid sequence from the cytoplasmic carboxy-terminus is necessary for interaction with the motor protein ... "Mutation of the beta-amyloid precursor protein in familial Alzheimer's disease increases beta-protein production". Nature. 360 ...
  https://en.wikipedia.org/wiki/Amyloid_precursor_protein
*  Nutrients | Free Full-Text | A Review on the Relationship between Tocotrienol and Alzheimer Disease | HTML
... phosphorylated tau and 42 amino acid isoform of beta-amyloid protein (Aβ42)), is made possible nowadays [2,3]. The combination ... peptide clusters formed as a result of misprocessed amyloid precursor protein (APP) by β- and γ- secretases. Several theories ... Cholesterol-protein binding blot assay later revealed that direct binding of cholesterol to the alpha-secretase cleavage site ... While distinguished in the temporal sequence of underlying pathogenic events, the 42-residue Aβ (Aβ42) isoform appears as the ...
  http://www.mdpi.com/2072-6643/10/7/881/htm
*  Patent US5981208 - Diagnostic assay for Alzheimer's disease based on the proteolysis of the ... - Google Patents
The absence of detectable proteolytic cleavage, or the detection of a substantially lesser degree of proteolytic cleavage, in ... such as comprising an APP substrate and immunoreagents for detecting a fragment formed by proteolytic cleavage as well as ... and poteolytic cleavage of the APP substrate is detected. ... of Alzheimer's Disease in a patient in which an amyloid protein ... precursor (APP) substrate is combined with a sample of cerebrospinal fluid or blood obtained from the patient to be tested, ...
  http://www.google.com.au/patents/US5981208
*  Identification of conserved polar residues in APH1 tran | Open-i
Amino Acid Sequence. *Amino Acid Substitution. *Amyloid Precursor Protein Secretases/metabolism. *Animals ... in the gamma/epsilon-secretase-regulated intramembranous proteolysis of substrates such as the amyloid-beta precursor protein ... and ϵ-cleavage sites within the APP-CTF. Mentions: Inspection of the primary sequence and membrane topology of APH1 revealed ... in the gamma/epsilon-secretase-regulated intramembranous proteolysis of substrates such as the amyloid-beta precursor protein ...
  https://openi.nlm.nih.gov/detailedresult.php?img=PMC2713549_zbc0280979160001&req=4
*  Method and composition for modulating amyloidosis - Patent # 5981168 - PatentGenius
Accordingly, the methods and compositions are useful for inhibiting amyloidosis in disorders in which amyloid deposition occurs ... "Release of excess amyloid .beta. protein from a mutant amyloid .beta. protein precursor", Science 259:514-516 (1993) and Reaume ... secretase (.beta., .gamma., right)sequentially cleave APP on either side of the A.beta. sequence. .beta. secretase cleavage ... The principal component of the senile plaque is the 4 kDa .beta.-amyloid peptide (A.beta.). Ranging between 39 and 43 amino ...
  http://www.patentgenius.com/patent/5981168.html
*  Cathepsin and methods and compositions for inhibition thereof - Patent # 5849711 - PatentGenius
... amyloid peptide (.beta.AP) from cells comprise administering to the cells certain compounds which inhibit the activity of an ... This invention is also directed to a nucleic acid sequence that encodes Cathepsin Y and the expression and isolation of ... The 31 kD protease has been designated Cathepsin Y. Screening methods for .beta.AP inhibitors rely on determining the activity ... approximately 31 kD protease involved in .beta.AP secretion. ... The term ".beta.-amyloid precursor protein" (APP) as used ...
  http://www.patentgenius.com/patent/5849711.html
*  Krtcap2 - Keratinocyte-associated protein 2 - Mus musculus (Mouse) - Krtcap2 gene & protein
May be involved in N-glycosylation of APP (amyloid-beta precursor protein). Can modulate gamma-secretase cleavage of APP by ... the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 ... complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). ... Sequence databases. Select the link destinations:. EMBL nucleotide sequence database. More...EMBLi. GenBank nucleotide sequence ...
  https://www.uniprot.org/uniprot/Q5RL79
*  Prediction of Memapsin 2 Cleavage Sites - Patent application
... low density lipoprotein receptor-related protein (LRP) (von Arnim et al., 2005) and amyloid-beta precursor-like proteins (APLPs ... Peptide sequence RK (P10)T(P9)E(P8)E(P7)I(P6)S(P5)E(P4)V(P- 3)N(P2)L(P1)D(P1')A(P2')E(P3')F(P4'), corresponding to the amino ... One of the most important physiological functions of memapsin 2 is the cleavage of a brain membrane protein β-amyloid precursor ... 1 × 10-16 14 aAPLP1 and APLP2 represent Amyloid beta (A4) precursor-like protein 1 and 2; mPGES-2 represents Membrane- ...
  http://www.patentsencyclopedia.com/app/20120100564
*  Application # 2018/0142011. Antibodies to Pyroglutamate Amyloid-B and Uses Thereof - Patents.com
The invention provides an antibody or antigen binding fragments thereof that binds to 3pE A.beta. and methods of making and ... A.beta.) peptides that are produced by cleavage of the .beta.-amyloid precursor protein (APP). Deposition of A.beta. peptides ... A.beta., comprising a heavy chain variable region comprising an amino acid sequence having a sequence identity of SEQ ID NO:2, ... A.beta.3pE-42), with little or no cross-reactivity to other A.beta. peptides or .beta.-amyloid precursor protein (APP). [0012] ...
  http://patents.com/us-20180142011.html
*  Alzheimerâ s Disease | Neurofibrillary Tangles | Amyloid-β-protein | Tau Protein
The alluvium of toxic amyloid-β-protein in th.. ... emblems of Alzheimer's disease are the accumulation of amyloid- ... Alpha-secretase cleavage of the amyloid precursor protein: proteolysis regulated by signaling pathways and protein trafficking ... The region that encodes Aβ-sequence consists of exons 16 and 17, and contains 40 and 43 amino acid residues. This region is ... Role of Amyloid-beta and Hyperphosphorylated Tau Protein. Rabia Sajjad, Rawaba Arif, A. A. Shah1, I. Manzoor1 and G. Mustafa2* ...
  http://www.ijpsonline.com/articles/pathogenesis-of-alzheimers-disease-role-of-amyloidbeta-and-hyperphosphorylated-tau-protein-3505.html?view=mobile
*  Cathepsin S - Wikipedia
"Lysosomal processing of amyloid precursor protein to A beta peptides: a distinct role for cathepsin S". The Biochemical Journal ... "The complete amino acid sequence of bovine cathepsin S and a partial sequence of bovine cathepsin L". FEBS Letters. 283 (2): ... For instance, cleavage of laminin-5 by cathepsin S leads to generation of proangiogenic peptides. The expression of cathepsin S ... Protein Engineering. 11 (11): 1007-13. doi:10.1093/protein/11.11.1007. PMID 9876921. Söderström M, Salminen H, Glumoff V, ...
  https://en.wikipedia.org/wiki/Cathepsin_S
*  Recombinant Human Presenilin 2 protein (ab114427) | Abcam
Ab114427 is a protein fragment produced in Wheat germ and has been validated in WB, ELISA, SDS-PAGE. Abcam… ... beta-amyloid precursor protein). Requires the other members of the gamma-secretase complex to have a protease activity. May ... an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP ... Amino Acid Sequence. * Accession. P49810. * Species. Human. * Sequence. MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQ ...
  http://www.abcam.com/recombinant-human-presenilin-2-protein-ab114427.html
*  Rapid and Direct Transport of Cell Surface APP to the Lysosome defines a novel selective pathway
A central feature of Alzheimer's disease is the cleavage of the amyloid precursor protein (APP) to form beta-amyloid peptide (A ... sequence encoding the 17 amino acid signal sequence of APP as well as the L-E residues required for signal peptide cleavage [55 ... Metabolism of the "Swedish" amyloid precursor protein variant in neuro2a (N2a) cells. Evidence that cleavage at the "beta- ... Targeting of cell-surface beta-amyloid precursor protein to lysosomes: alternative processing into amyloid-bearing fragments. ...
  http://pubmedcentralcanada.ca/pmcc/articles/PMC2868040/
*  Anti-beta Amyloid 1-40 antibody (ab17295) | Abcam
Rabbit polyclonal beta Amyloid 1-40 antibody validated for WB, ELISA and tested in Human and Mouse. Immunogen corresponding to ... The NPXY sequence motif found in many tyrosine-phosphorylated proteins is required for the specific binding of the PID domain. ... Trophic-factor deprivation triggers the cleavage of surface APP by beta-secretase to release sAPP-beta which is further cleaved ... derived proteolytically from the transmembrane precursor protein APP by sequential secretase processing. The cytotoxic C- ...
  http://www.abcam.com/beta-amyloid-1-40-antibody-ab17295.html
*  Anti-beta Amyloid 1-40 antibody [BDI350] (ab20068)
Mouse monoclonal beta Amyloid 1-40 antibody [BDI350] validated for WB, ELISA, IHC, ICC and tested in Human. Referenced in 1 ... The NPXY sequence motif found in many tyrosine-phosphorylated proteins is required for the specific binding of the PID domain. ... Trophic-factor deprivation triggers the cleavage of surface APP by beta-secretase to release sAPP-beta which is further cleaved ... derived proteolytically from the transmembrane precursor protein APP by sequential secretase processing. The cytotoxic C- ...
  http://www.abcam.com/beta-amyloid-1-40-antibody-bdi350-ab20068.html
*  IL1A - Wikipedia
... is primarily responsible for the cleavage of the IL-1α precursor into a mature molecule. Both the 31kDa precursor form of IL-1α ... release of all types of amino acids in blood and stimulates acute-phase proteins synthesis changes the metallic ion content of ... The three-dimensional structure of the IL-1α contains an open-ended barrel composed entirely of beta-pleated strands. Crystal ... serum amyloid A inducer or hepatocyte-stimulating factor (HSP), catabolin, hemopoetin-1 (H-1), endogenous pyrogen (EP), and ...
  https://en.wikipedia.org/wiki/IL1A
*  Amyloid beta - Wikipedia
"Beta-secretase cleavage of Alzheimer's amyloid precursor protein by the transmembrane aspartic protease BACE". Science. 286 ( ... Amyloid beta (Aβ or Abeta) denotes peptides of 36-43 amino acids that are crucially involved in Alzheimer's disease as the main ... However the central sequence KLVFFAE is known to form amyloid on its own, and probably forms the core of the fibril.[citation ... Hiltunen M, van Groen T, Jolkkonen J (2009). "Functional roles of amyloid-beta protein precursor and amyloid-beta peptides: ...
  https://en.wikipedia.org/wiki/Amyloid_beta
*  A Window into the Heterogeneity of Human Cerebrospinal Fluid Aβ Peptides
S. S. Sisodia, "β-Amyloid precursor protein cleavage by a membrane-bound protease," Proceedings of the National Academy of ... "Amino-terminal modification and tyrosine phosphorylation of carboxy-terminal fragments of the amyloid precursor protein in ... "Mechanisms of amyloid-beta peptide uptake by neurons: the role of lipid rafts and lipid raft-associated proteins," ... β sequence, we tested whether the combined use of these two mAbs could improve the capture of N and C-terminally truncated Aβ ...
  https://www.hindawi.com/journals/bmri/2011/697036/
*  Insulin-degrading enzyme - Wikipedia
... amyloid beta-protein, and the beta-amyloid precursor protein intracellular domain in vivo". Proceedings of the National Academy ... This discovery revealed considerable amino acid sequence similarity between IDE and the previously characterized bacterial ... This activity was observed over sixty years ago, though the enzyme specifically responsible for B chain cleavage was identified ... Kerr ML, Small DH (Apr 2005). "Cytoplasmic domain of the beta-amyloid protein precursor of Alzheimer's disease: function, ...
  https://en.wikipedia.org/wiki/Insulin-degrading_enzyme
*  Method of screening for compounds which affect the processing of EphA4 by .gamma.-secretase - Patent # 7910324 -...
... those candidate compounds which affect the cleavage of the EphA4 by .gamma.-secretase; and (iv) identifying the candidate ... measuring the cleavage of the EphA4 in the presence and absence of the candidate compound; (iii) selecting ... amyloid precursor protein (.beta.APP) or a mutant thereof. APP is a single-pass transmembrane protein comprising an A.beta. ... is classified into peptides with differentlengths depending on the cleavage site in the amino acid sequence (C-terminal side). ...
  http://www.patentgenius.com/patent/7910324.html
*  Recombinant Human Amyloid Precursor Protein (ab124588)
Recombinant Human Amyloid Precursor Protein Protein fragment datasheet (ab124588). Abcam offers quality products including ... Trophic-factor deprivation triggers the cleavage of surface APP by beta-secretase to release sAPP-beta which is further cleaved ... The NPXY sequence motif found in many tyrosine-phosphorylated proteins is required for the specific binding of the PID domain. ... However, additional amino acids either N- or C-terminal to the NPXY motif are often required for complete interaction. The PID ...
  http://www.abcam.co.jp/recombinant-human-amyloid-precursor-protein-ab124588.html