*  A novel senescence-evasion mechanism involving Grap2 and Cyclin D interacting protein inactivation by Ras associated with...
Ras associated with diabetes (Rad) is a Ras-related GTPase that promotes cell growth by accelerating cell cycle transitions. Rad knockdown induced cell cycle arrest and premature senescence without additional cellular stress in multiple cancer cell l
  http://www.biomedsearch.com/nih/Novel-Senescence-Evasion-Mechanism-Involving/20460530.html
*  CCZ1 - Vacuolar fusion protein CCZ1 homolog - Homo sapiens (Human) - CCZ1 gene & protein
Acts in concert with MON1A, as a guanine exchange factor (GEF) for RAB7, promotes the exchange of GDP to GTP, converting it from an inactive GDP-bound form into an active GTP-bound form (PubMed:23084991).
  http://www.uniprot.org/uniprot/P86791
*  RCSB PDB - 1C1Y: CRYSTAL STRUCTURE OF RAP.GMPPNP IN COMPLEX WITH THE RAS-BINDING-DOMAIN OF C-RAF1 KINASE (RAFRBD)....
1C1Y: The 2.2 A crystal structure of the Ras-binding domain of the serine/threonine kinase c-Raf1 in complex with Rap1A and a GTP analogue.
  http://www.rcsb.org/pdb/explore/litView.do?structureId=1C1Y
*  The Panopticon: Out of the Sketchbook
Kondiloma akuminatum ialah vegetasi oleh Human Papiloma Virus tipe tertentu, bertangkai, dan permukaannya berjonjot. Tipe HPV tertentu mempunyai potensi onkogenik yang tinggi, yaitu tipe 16 dan 18. tipe ini merupakan jenis virus yang paling sering dijumpai pada kanker serviks. Sedangkan tipe 6 dan 11 lebih sering dijumpai pada kondiloma akuminatum dan neoplasia intraepitelial serviks derajat ringan. Kondiloma akuminatum ialah vegetasi oleh Human Papiloma Virus tipe tertentu, bertangkai, dan permukaannya berjonjot. Tipe HPV tertentu mempunyai potensi onkogenik yang tinggi, yaitu tipe 16 dan 18. tipe ini merupakan jenis virus yang paling sering dijumpai pada kanker serviks. Sedangkan tipe 6 dan 11 lebih sering dijumpai pada kondiloma akuminatum dan neoplasia intraepitelial serviks derajat ringan. ...
  http://the-panopticon.blogspot.com/2009/12/out-of-sketchbook.html?showComment=1261262519189
*  The Panopticon: Out of the Sketchbook
Kondiloma akuminatum ialah vegetasi oleh Human Papiloma Virus tipe tertentu, bertangkai, dan permukaannya berjonjot. Tipe HPV tertentu mempunyai potensi onkogenik yang tinggi, yaitu tipe 16 dan 18. tipe ini merupakan jenis virus yang paling sering dijumpai pada kanker serviks. Sedangkan tipe 6 dan 11 lebih sering dijumpai pada kondiloma akuminatum dan neoplasia intraepitelial serviks derajat ringan. Kondiloma akuminatum ialah vegetasi oleh Human Papiloma Virus tipe tertentu, bertangkai, dan permukaannya berjonjot. Tipe HPV tertentu mempunyai potensi onkogenik yang tinggi, yaitu tipe 16 dan 18. tipe ini merupakan jenis virus yang paling sering dijumpai pada kanker serviks. Sedangkan tipe 6 dan 11 lebih sering dijumpai pada kondiloma akuminatum dan neoplasia intraepitelial serviks derajat ringan. ...
  http://the-panopticon.blogspot.com/2009/12/out-of-sketchbook.html?showComment=1261265351632
*  Produktübersicht anti-RALB Antikörper
Monoklonale und polyklonale RALB Antikörper für viele Methoden. Ausgesuchte Qualitäts-Hersteller für RALB Antikörper. Hier bestellen.
  http://www.antikoerper-online.de/neurotrophin-signal%C3%BCbertragung-pathway-29/ralb-antibody-18580/
*  KEGG PATHWAY: Ras signaling pathway - Homo sapiens (human)
The Ras proteins are GTPases that function as molecular switches for signaling pathways regulating cell proliferation, survival, growth, migration, differentiation or cytoskeletal dynamism. Ras proteins transduce signals from extracellular growth factors by cycling between inactive GDP-bound and active GTP-bound states. The exchange of GTP for GDP on RAS is regulated by guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs). Activated RAS (RAS-GTP) regulates multiple cellular functions through effectors including Raf, phosphatidylinositol 3-kinase (PI3K) and Ral guanine nucleotide-dissociation stimulator (RALGDS ...
  http://www.genome.jp/kegg-bin/show_pathway?hsa04014+5594+5869
*  The exocyst is required for trypanosome invasion and the repair of mechanical plasma membrane wounds | Journal of Cell Science
Given that the exocyst plays a role in spatially targeting vesicles to the plasma membrane (Heider and Munson, 2012), we also investigated whether the depletion of exocyst components had a differential effect on the repair of polarized (mechanical) and non-polarized (pore-forming toxin SLO) wounds. After SLO exposure, cells were incubated under conditions that were permissive (Ca2+) or non-permissive (no Ca2+) for plasma membrane repair, and exposed to the membrane-impermeant dye propidium iodide. Cells treated with control or Exo70-specific siRNA were equally capable of resealing their plasma membrane after SLO permeabilization in the presence of Ca2+, as indicated by the block in uptake (Fig. 2C, right panels). As expected, without Ca2+, permeabilized cells did not reseal, allowing propidium iodide influx (Fig. 2C, left panels). Flow cytometric quantification of propidium-iodide-positive cells confirmed that depletion of Exo70 (Fig. 2D) or Sec8 (Fig. 2E) did not affect the ability of the cells ...
  http://jcs.biologists.org/content/128/1/27
*  Different metastasis promotive potency of small G-proteins RalA and RalB in in vivo hamster tumor model | Cancer Cell...
Molecular pathways regulating tumor metastasis to distant organs are still poorly understood. Research in this area is hampered by multiplicity and complexity of steps and factors involved in this process and by the absence of criteria determining the metastatic behavior.. Common in vivo models used in different studies are based either on mouse cell lines or on human cultures injected into immunocompromised animals. The model system used here includes HET-SR line that is characterized by high tumorigenicity (minimal subcutaneous inoculation dose - 200 cells) and low lung specific spontaneous metastasis (0-5 metastatic nodules per lung) in syngeneic immunocompetent animals [32-35].. According to mouse models of tumor progression it was previously considered that major Ras-downstream pathways are Raf-MAPK and PI3K signaling cascades. However, further investigation has shown that Ras-RalGEF-Ral signaling in humans dominated in driving Ras mediated progression ...
  https://cancerci.biomedcentral.com/articles/10.1186/1475-2867-11-22
*  Wei Guo | Department of Biology
Luo, G., Zhang, J., Luca, F., Guo, W. Mitotic phosphorylation of Exo84 disrupts exocyst assembly and arrests cell growth. J. Cell Biol. (2013) 202 (1): 97-111. Ren, J. and Guo, W. ERK1/2 regulates post-Golgi exocytosis through phosphorylation of the exocyst component Exo70. Developmental CELL (2012) 22(5):967-978.. Liu, J., Zhao, Y., Sun, Y., Yang, C., He, B., Goldman Y., Svitkina, T., Guo, W. Exo70 stimulates actin branching for lamellipodia formation and cell migration. Current Biology (2012) 22:1510-1515.. Feng, S, Knödler A, Zhang, J., Zhang, X., Huang, S., Peränen, J., Guo, W. A Rab8 GEF-effector interaction network regulates primary ciliogenesis. J. Biol. Chem. (2012) 287:15602-15609.. Sakamori, R, Das, S, Feng, S, Stypulkowski, E, Harada, A., Brakebusch, C., Guo, W., Gao N. Cdc42 and Rab8a control stem cell division, survival, and differentiation in mouse intestine. J Clin Invest. (2012) 122(3):1052-65.. Das, A. and Guo, W. Rabs and exocyst in ciliogenesis, lumenogenesis and beyond. ...
  https://www.bio.upenn.edu/people/wei-guo
*  AS27 15897 - Exocyst complex component 3 - Aptenodytes forsteri (Emperor penguin) - AS27 15897 gene & protein
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
  http://www.uniprot.org/uniprot/A0A087QWY3
*  N322 02940 - Exocyst complex component 3 - Cariama cristata (Red-legged seriema) - N322 02940 gene & protein
p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.,/p> ,p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.,/p> ,p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).,/p> ,p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x,sup>64,/sup> + x,sup>4,/sup> + x,sup>3,/sup> + x + 1. The algorithm is described in the ISO 3309 standard. ,/p> ,p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.,br /> ,strong>Cyclic redundancy and other checksums,/strong>,br /> ,a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993),/a>),/p> Checksum:i ...
  http://www.uniprot.org/uniprot/A0A091M0R9
*  GTP Hydrolysis of TC10 Promotes Neurite Outgrowth through Exocytic Fusion of Rab11- and L1-Containing Vesicles by Releasing...
GTP Hydrolysis of TC10 Promotes Neurite Outgrowth through Exocytic Fusion of Rab11- and L1-Containing Vesicles by Releasing Exocyst Component Exo70. . Download books free in pdf. Online library with books, university works and thousands of documents available to read online and download.
  http://books.duhnnae.com/2017/jun8/149831306945-GTP-Hydrolysis-of-TC10-Promotes-Neurite-Outgrowth-through-Exocytic-Fusion-of-Rab11-and-L1-Containing-Vesicles-by-Releasing-Exocyst-Component-Exo70.php
*  Publications - Laboratory of Cell Biology
Zhang CH, Brown MQ, van de Ven W, Zhang ZM, Wu B, Young MC, Synek L, Borchardt D, Harrison R, Pan SQ, Luo N, Huang YMM, Ghang YJ, Ung N, Li RX, Isley J, Morikis D, Song JK, Guo W, Hooley RJ, Chang CEA, Yang ZB, Žárský V, Muday GK, Hicks GR, Raikhel NV. (2016) Endosidin2 targets conserved exocyst complex subunit EXO70 to inhibit exocytosis. PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 113(1):E41-E50. ...
  http://www.cellbiology.cz/publications
*  EXOC4 Gene - GeneCards | EXOC4 Protein | EXOC4 Antibody
Complete information for EXOC4 gene (Protein Coding), Exocyst Complex Component 4, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
  http://www.genecards.org/cgi-bin/carddisp.pl?id_type=entrezgene&id=60412
*  KEGG T01010: 399470
xla:399470 K07827 GTPase KRas , (RefSeq) ralb, KRAS2, k-ras, xralb; v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (A) MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNIKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQFRLKKMSKEEKTPGC VKFKKCRVM ...
  http://www.genome.jp/dbget-bin/www_bget?-f+-n+a+xla:399470
*  The Rap1-cofilin-1 pathway coordinates actin reorganization and MTOC polarization at the B cell immune synapse | Journal of...
The IS is a polarized cell structure similar to the leading edge of a migrating cell or the yeast bud site. Establishing functional patterns of membrane protein organization and vesicular traffic at these sites requires coordinated reorganization of the actin and microtubule cytoskeletons. Rap1 is an evolutionarily conserved regulator of cell polarity that drives actin reorganization at the B cell IS (Lin et al., 2008). We have now shown that Rap1, and its downstream target, the actin-severing protein cofilin, are essential for BCR-induced MTOC polarization towards the IS. Whether Rap1 controls MTOC reorientation in other immune cells is not known. The BCR and TCR both activate Rap1 via phospholipase Cγ-dependent production of diacylglycerol (Katagiri et al., 2004; McLeod et al., 1998), which recruits the Rap1 exchange factor RasGRP2 (also known as CalDAG-GEFI) (Kawasaki et al., 1998) to the plasma membrane. The scaffolding protein ADAP (also known as FYB), which promotes ...
  http://jcs.biologists.org/content/130/6/1094?rss=1
*  CIN85 associates with multiple effectors controlling intracellular trafficking of epidermal growth factor receptors.
CIN85 is a multidomain adaptor protein involved in Cbl-mediated down-regulation of epidermal growth factor (EGF) receptors. CIN85 src homology 3 domains specifically bind to a proline-arginine (PxxxPR) motif in Cbl, and this association seems to be important for EGF receptor endocytosis. Here, we report identification of novel CIN85 effectors, all containing one or more PxxxPR motifs, that are indispensable for their mutual interactions. These effectors include phosphatidyl-inositol phosphatases SHIP-1 and synaptojanin 2B1, Arf GTPase-activating proteins ASAP1 and ARAP3, adaptor proteins Hip1R and STAP1, and a Rho exchange factor, p115Rho GEF. Acting as a molecular scaffold, CIN85 clusters its effectors and recruits them to high-molecular-weight complexes in cytosolic extracts of cells. Further characterization of CIN85 binding to ASAP1 revealed that formation of the complex is independent on cell stimulation. Overexpression of ASAP1 increased EGF receptor ...
  http://uu.diva-portal.org/smash/record.jsf?pid=diva2:38096
*  Aarskog Scott affection
Aarskog affection is an affiliated disease. The Aarskog Scott affection is a ataxia with abrupt height, hypertelorism, downslanting palpebral fissures, anteverted nostrils, multilateral laxity, capote scrotum, and cerebral retardation. The concrete phenotype varies with age and postpuberal males may get artlessly bush balance manifestations of the prepuberal phenotype. It is a X-linked backward ancestral disorder, thus, mainly males are affected, although females may get a milder announcement of some of the features. The Aarskog affection is too accepted as the Aarskog Scott syndrome, faciodigitogenital syndrome, capote scrotum affection and faciogenital dysplasia. It is acquired by mutations in a gene alleged "faciogenital dysplasia" authorize on the X chromosome.. A accident agency is article that increases your adventitious of accepting a ache or condition. This ataxia mainly affects males. Aarskog ...
  http://www.world-health.net/tag/aarskog-scott-affection
*  The immunoglobulin superfamily in Caenorhabditis elegans and Drosophila melanogaster | Development
IgSF proteins are classified in this paper according to their domain organization. Although this is a useful classification from a structural point of view, it has only limited implications for the functions of the proteins. Treating these structural classes as being equivalent to functional classes is incorrect as members from each class have been shown to have overlapping functions. For example, most members of the `Cell Surface I protein' class, classified as `cell adhesion proteins' by Vogel et al., can clearly serve as signaling molecules (e.g. L1, NCAM, Robo and DSCAM) (reviewed by Rougon and Hobert, 2003). To illustrate one example, the Robo IgSF protein is classified as a cell adhesion protein by Vogel et al., yet it has clearly been demonstrated to be a signaling molecule acting through the recruitment of intracellular signal transducing molecules, such as kinases and nucleotide exchange factors (reviewed by Araujo ...
  http://dev.biologists.org/content/131/10/2237
*  "Inhibition of guanine nucleotide synthesis by mycophenolate. Biologic" by J K. Lowe and J F. Henderson
Lowe, J K. and Henderson, J F., "Inhibition of guanine nucleotide synthesis by mycophenolate. Biological and biochemical consequences. Abstr." (1976). Subject Strain Bibliography 1976. 1485 ...
  http://mouseion.jax.org/ssbb1976/1485/
*  Regulation of ligand binding to leukotriene D4 receptors: effects of cations and guanine nucleotides
Mong, S.; Wu, H.L.; Hogaboom, G.K.; Clark, M.A.; Stadel, J.M.; Crooke, S.T., 1984: Regulation of ligand binding to leukotriene D4 receptors: effects of cations and guanine nucleotides
  https://eurekamag.com/research/044/174/044174724.php
*  Arfs at a Glance | Journal of Cell Science
There are six subfamilies of Arf GEFs in eukaryotes (see poster). The GBF/Gea and BIG/Sec7 GEFs function sequentially in the secretory pathway, with GBF/Gea proteins acting at the early Golgi, and BIG/Sec7 proteins at the trans-Golgi and TGN (Donaldson and Jackson, 2011). The cytohesin/Arno, EFA6 and IQSEC/BRAG subfamilies function primarily in endosome-plasma-membrane trafficking pathways at the cell periphery, the latter two using Arf6 as a substrate (Casanova, 2007; Gillingham and Munro, 2007). The FBXO8 GEFs, restricted primarily to vertebrates, contain an F-box in addition to the Sec7 domain (Gillingham and Munro, 2007). Arf activation by GBF/Gea and BIG/Sec7 GEFs is inhibited by the drug brefeldin A, which traps a Sec7-domain-Arf-GDP complex (Mossessova et al., 2003; Peyroche et al., 1999; Renault et al., 2003).. Many GEFs exist in an autoinhibited state in the cytosol, with their activation coupled to membrane recruitment. At the plasma membrane, the Pleckstrin homology (PH) domains of ...
  http://jcs.biologists.org/content/127/19/4103
*  Activation of Ras Requires the ERM-Dependent Link of Actin to the Plasma Membrane
Background Receptor tyrosine kinases (RTKs) participate in a multitude of signaling pathways, some of them via the small G-protein Ras. An important component in the activation of Ras is Son of sevenless (SOS), which catalyzes the nucleotide exchange on Ras. Principal Findings We can now demonstrate that the activation of Ras requires, in addition, the essential participation of ezrin, radixin and/or moesin (ERM), a family of actin-binding proteins, and of actin. Disrupting either the interaction of the ERM proteins with co-receptors, down-regulation of ERM proteins by siRNA, expression of dominant-negative mutants of the ERM proteins or disruption of F-actin, abolishes growth factor-induced Ras activation. Ezrin/actin catalyzes the formation of a multiprotein complex consisting of RTK, co-receptor, Grb2, SOS and Ras. We also identify binding sites for both Ras and SOS on ezrin; mutations of these binding sites destroy the interactions and inhibit Ras ...
  http://journals.plos.org/plosone/article?id=10.1371/journal.pone.0027511
*  Classic Elite Pebbles Yarn - 2824 Deep Indigo Project Ideas at Jimmy Beans Wool
Classic Elite Pebbles Yarn - 2824 Deep Indigo - Project Ideas. Classic Elite Pebbles Yarn - 2824 Deep Indigo is available now at Jimmy Beans Wool with Free U.S. Flat Rate shipping for orders over $75, $4 U.S. Flat Rate shipping on all other orders!
  https://www.jimmybeanswool.com/knitting/yarn/ClassicElite/PebblesSuggested.asp?showLarge=true&specPCVID=46388