Pulmonary surfactant protein D (SP-D) is a protein domain predominantly found in lung surfactant. This protein plays a special ... Pulmonary surfactant protein D (SP-D), has an important role in acting as a lung host defence protein. SP-D has a significant ... June 2001). "The amino-terminal heptad repeats of the coiled-coil neck domain of pulmonary surfactant protein d are necessary ... March 2006). "Surfactant proteins SP-A and SP-D: structure, function and receptors". Molecular Immunology. 43 (9): 1293-315. ...
Pulmonary Surfactant-Associated Protein A/genetics/*metabolism, Pulmonary Surfactant-Associated Protein B/genetics/*metabolism, ... Pulmonary surfactant protein A, B, and C mRNA and protein expression in the nitrofen-induced congenital diaphragmatic hernia ... Pulmonary Surfactant-Associated Protein C/genetics/*metabolism, RNA, Messenger/*metabolism, Rats, Rats, Wistar, Research ... In this study, we tested the possibility that CDH lungs are surfactant protein deficient, which could explain the respiratory ...
Mutations in the surfactant protein C (SP-C) gene (SFTPC) are associated with familial desquamative and nonspecific ... Familial pulmonary fibrosis is a heterogeneous group of interstitial lung diseases of unknown cause that is associated with ... Familial pulmonary fibrosis is a heterogeneous group of interstitial lung diseases of unknown cause that is associated with ... Mutations in the surfactant protein C (SP-C) gene (SFTPC) are associated with familial desquamative and nonspecific ...
We have isolated a surfactant-associated protein complex with molecular weight components of 36 000, 32 000, and 28 000 an … ... Previous studies have demonstrated that lung-specific proteins are associated with surfactant lipids, particularly the highly ... Proteins / isolation & purification * Proteins / metabolism* * Pulmonary Surfactants / isolation & purification * Pulmonary ... Effects of a surfactant-associated protein and calcium ions on the structure and surface activity of lung surfactant lipids ...
Ask ELISA Kit for Bovine Pulmonary Surfactant Associated Protein C(SP-C). ... Related article about: ELISA Kit for Bovine Pulmonary Surfactant Associated Protein C(SP-C) ... ELISA Kit for Human Nuclear Matrix Protein 22(NMP22) ELISA Kit for Human Nuclear Mitotic Apparatus Protein 1(NUMA1) ELISA Kit ... ELISA Kit for Human Nucleolar Protein 1(NOL1) ELISA Kit for Human Nucleolin(NCL) ELISA Kit for Human Nucleophosmin(NPM1) ELISA ...
... stain-positive phospholipoprotein that is derived from surfactant. The lung architecture is otherwise normal, and any ... Pulmonary alveolar proteinosis (PAP) is a rare, diffuse lung disease that is characterized by the alveolar and interstitial ... Surfactant proteins in pulmonary alveolar proteinosis in adults. Eur Respir J. 2004 Sep. 24(3):426-35. [QxMD MEDLINE Link]. [ ... encoded search term (Pulmonary Alveolar Proteinosis Imaging) and Pulmonary Alveolar Proteinosis Imaging What to Read Next on ...
Firstly, the pulmonary surfactant proteins (e.g. SP-A and SP-B) would bind to carbon nanomaterials in the lungs. The complexes ... According to previous reports, the pulmonary surfactant proteins (e.g., SP-A and SP-B) can be bonded to COOH/OH on the surfaces ... The binding of pulmonary surfactant proteins (SP-A or SP-B) to NDs could promote their clearance rate from the lungs [19]. NDs ... Binding of pulmonary surfactant proteins to carbon nanotubes; potential for damage to lung immune defense mechanisms. Carbon ...
Rat SP-D (Pulmonary surfactant-associated protein D) ELISA Kit , G-EC-05617 Rat SP-D (Pulmonary surfactant-associated protein D ... Rat SP-D (Pulmonary surfactant-associated protein D) ELISA Kit , G-EC-05617 ... Mouse SP-D (Pulmonary surfactant-associated protein D) ELISA Kit , G-EC-04660 ... Human SP-D (Pulmonary surfactant-associated protein D) ELISA Kit , G-EC-02962 ...
Regulation and function of pulmonary surfactant protein B.﻽. Pryhuber GS. Molecular genetics and metabolism.. 1998 August 64 (4 ... G-protein-coupled receptor kinase interacting protein-1 is required for pulmonary vascular development.﻽. Pang J, Hoefen R, ... Regulation of surfactant proteins A and B by TNF-alpha and phorbol ester independent of NF-kappa B.﻽. Pryhuber GS, Khalak R, ... Regulation of surfactant proteins A and B by TNF-? and phorbol ester independent of NF-?B.﻽. Pryhuber GS, Khalak R, Zhao Q ...
Surfactant is produced by alveolar type II cells which can be differentiated in vitro from patient specific induced pluripotent ... We also show the presence of normal lamellar bodies and the secretion of surfactant into the cell culture medium in the ... we show expression of SFTPB mRNA during endodermal and organoid differentiation but the protein product only after organoid ... Surfactant protein B (SFTPB) deficiency is a fatal disease affecting newborn infants. ...
PDB Compounds: (B:) Pulmonary surfactant-associated protein D. SCOPe Domain Sequences for d2orkb2:. Sequence; same for both ... PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein D in ... d2orkb2 h.1.1.1 (B:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]} aslrqqvealqgqvqhlqaafsqykkvelf SCOPe ... Class h: Coiled coil proteins [57942] (7 folds). *. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies). this is not a ...
Mannose-Binding Protein A, subunit A Functional Family. Pulmonary surfactant-associated protein D ... High resolution structural insights into ligand binding and immune cell recognition by human lung surfactant protein D ... CATH: Protein Structure Classification Database by I. Sillitoe, N. Dawson, T. Lewis, D. Lee, J. Lees, C. Orengo is licensed ...
It is a syndrome characterized by marked pulmonary hypertension that causes hypoxemia and right-to-left intracardiac shunting ... Persistent pulmonary hypertension of the newborn (PPHN) is defined as the failure of the normal circulatory transition that ... genetic mutations leading to surfactant protein B deficiency, and mutations in the ATP-binding cassette transporter 3 gene. [4 ... Hypoplasia of the pulmonary vascular bed. Hypoplasia of the pulmonary vascular bed is another cause of persistent pulmonary ...
Pulmonary surfactant protein A (SP-A), a heterooligomer of SP-A1 and SP-A2, is an important regulator of innate immunity of the ... Identification and Quantitation of Coding Variants and Isoforms of Pulmonary Surfactant Protein A ... Ledfords current work in the area of pulmonary surfactant immunobiology combines her knowledge of mouse genetics, pulmonary ... Identification and Quantitation of Coding Variants and Isoforms of Pulmonary Surfactant Protein A. Journal of proteome research ...
Effects on pulmonary surfactant secretion were assessed through changes in phospholipid content of the lavagate. Phosgene alone ... Lung lavage fluid was used for neutrophil counts and protein concentration determinations. Changes in alveolar/capillary ... Colchicine inhibits elevations in both alveolar-capillary membrane permeability and lavage surfactant after exposure of the rat ... NIOSH-Publication; NIOSH-Grant; Pulmonary-system-disorders; Drugs; Toxic-gases; Organo-chlorine-compounds; In-vivo-studies; ...
Pulmonary surfactant, also known as lung surfactant, is a detergent-like, lipid-protein mixture synthesized by alveolar type II ... Heat shock protein 90 (Hsp90) is a master chaperone, regulating processes involved in cell cycle control, protein folding, and ... A proteins natively folded state, as we call it, may or may not be an energy-minimized state. It can very well be a state with ... bps1526 career advice25 presentation23 stem16 students14 nih13 funding12 Philadelphia12 science policy12 Proteins11 disease ...
3 People Results for the Tag: Pulmonary Surfactant Associated Protein A. .remove { display: block; cursor: pointer; float: ...
Next are patients with genetic mutations in: surfactant protein B (SFTPB), ABCA3, surfactant protein C (SFTPC) and pulmonary ... pulmonary fibrosis, disorders of surfactant homeostasis (figure 1), asthma, chronic obstructive lung disease (COPD) and cystic ... Division of Pulmonary Biology. 3333 Burnet Ave. Cincinnati, OH 45229-3039. Phone: 513-803-2790. Email: [email protected] ... Assess mechanisms controlling surfactant homeostasis at the cellular and molecular level Educational Opportunities. *PhD and MD ...
... that could be used in development of a sputum test for early detection of chronic obstructive pulmonary disease (COPD). That ... Proteomics of Human Lung Tissue Identifies Surfactant Protein A as a Marker of Chronic Obstructive Pulmonary Disease. Journal ... Past research pointed to a prime candidate - surfactant protein A (SP-A), which has a major role in fighting infections and ... Advance Toward Early Diagnosis Of Chronic Obstructive Pulmonary Disease. Date:. December 17, 2008. Source:. American Chemical ...
i,Objective.,/i, To determine the correlation between maternal bile acid (BA) level and fetal pulmonary surfactant in rats and ... H. Maeda, M. Q. Fujita, B.-L. Zhu et al., "Pulmonary surfactant-associated protein A as a marker of respiratory distress in ... I. R. Doyle, T. E. Nicholas, and A. D. Bersten, "Serum surfactant protein-A levels in patients with acute cardiogenic pulmonary ... SP-A acts as a pulmonary surfactant binding protein and is secreted by type II pneumonocyte. When the lung is damaged, the ...
Pulmonary surfactant is mainly composed of phospholipids and minor amounts of other lipids and specific proteins. Surfactant ... "Decreased surfactant lipids correlate with lung function in chronic obstructive pulmonary disease (COPD) PLoS One 15(2) ... In the lab, we use cell culture and in vivo models to study the regulation of surfactant homeostasis and its dysregulation ... Pulmonary metabolism in smoke-related disease. Icahn School of Medicine at Mount Sinai, New York (2014-2015) ...
Surfactant protein C mutations and familial pulmonary fibrosis: stuck in a loop on the scenic route European Respiratory ... Doveston RG Cooperative stabilisation of 14-3-3σ protein-protein interactions via covalent protein modification Chemical ... Discovering protein-protein interaction stabilisers by native mass spectrometry Chemical Science 12: 10724-10731 ... Thurairajah B, Hudson AJ Doveston RG Contemporary biophysical approaches for studying 14-3-3 protein-protein interactions Front ...
Pulmonary surfactant-associated protein A1. MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGL.... unknown. Manganese catalase ... Tyrosine-protein kinase transforming protein Abl. YITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSIS.... unknown. Bifunctional ... Hypothetical gliding protein. MVEPSLVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWA.... unknown. Prolyl endopeptidase Pep. ... Thiol:disulfide interchange protein DsbC. MKKGFMLFTLLAAFSGFAQADDAAIQQTLAKMGIKSSDIQPAPVAGMKTV.... unknown. Glyceraldehyde-3- ...
Surfactant dysfunction is a lung disorder that causes breathing problems. Explore symptoms, inheritance, genetics of this ... and surfactant protein-C (SP-C), respectively, two of the four proteins in surfactant. These two proteins help spread the ... An overview of pulmonary surfactant in the neonate: genetics, metabolism, and the role of surfactant in health and disease. Mol ... Hamvas A. Inherited surfactant protein-B deficiency and surfactant protein-C associated disease: clinical features and ...
Surfactant protein A (SP-A) is the major protein component of pulmonary surfactant, a material secreted by the alveolar type II ... Immunomodulatory functions of surfactant. Wright, J.R. Physiol. Rev. (1997) [Pubmed]. *Pulmonary surfactant protein B (SP-B): ... SP-B is a protein in pulmonary surfactant that is, in greatest part, responsible for resistance to surface tension and ... The role of pulmonary collectin N-terminal domains in surfactant structure, function, and homeostasis in vivo. Palaniyar, N., ...
Pulmonary Surfactant-Associated Protein D 100% * Chronic Obstructive Pulmonary Disease 60% * Blood Proteins 60% ... Incidence of Chronic Pulmonary Aspergillosis in Patients with Suspected or Confirmed NTM and TB-A Population-Based ... Targeted AntiBiotics for Chronic pulmonary diseases (TARGET ABC): can targeted antibiotic therapy improve the prognosis of ... International Journal of Chronic Obstructive Pulmonary Disease. 16, p. 1621-1636. Research output: Contribution to journal › ...
Surfactant protein A. Surfactant protein A is an innate immune system collectin.- During Parturition :The role of Surfactant ... Proteins. Proteins make up the remaining 10% of the surfactant. Half of this 10% is plasma proteins but the rest is formed by ... Mini review on Pulmonary Surfactant Minireview covering composition, function and pathologies of Pulmonary Surfactant ... Artificial surfactants. Synthetic pulmonary surfactants * Exosurf - a mixture of DPPC with hexadecanol and tyloxapol added as ...
A synthetic non-palmitoylated form of the pulmonary surfactant protein SP-C and three peptides of different lengths ... Decreased pulmonary levels of the anti-inflammatory Clara cell 16 kDa protein after induction of airway inflammation in ... Native pulmonary-surfactant-associated lipopolypeptide SP-C, its chemically depalmitoylated form and several synthetic ... Structural and Functional Importance of the C-Terminal Part of the Pulmonary Surfactant Polypeptide SP-C ...
Hyaluronan and TLR4 promote surfactant-protein-C-positive alveolar progenitor cell renewal and prevent severe pulmonary ... 22, 1285-1293 (2016). This work discovered an anti-fibrotic mechanism for hyaluronan in pulmonary fibrosis, revealing a novel ... Stretch-induced activation of transforming growth factor-β1 in pulmonary fibrosis. Am. J. Respir. Crit. Care Med. 194, 84-96 ( ... Progressive pulmonary fibrosis is caused by elevated mechanical tension on alveolar stem cells. Cell 180, 107-121 (2020). ...
KL-6, surfactant protein A and D in bronchoalveolar lavage fluid from patients with pulmonary sarcoidosis. Respiration. 2001. ... Stephen P Peters, MD, PhD, FACP, FAAAAI, FCCP, FCPP Thomas H Davis Chair in Pulmonary Medicine, Chief, Section on Pulmonary, ... Long term follow-up of infliximab efficacy in pulmonary and extra-pulmonary sarcoidosis refractory to conventional therapy. ... Pulmonary function tests and a carbon monoxide diffusion capacity test of the lungs for carbon monoxide (DLCO) may be performed ...