*  Viruses | Free Full-Text | Functional Characterization of Cucumis metuliferus Proteinase Inhibitor Gene (CmSPI) in Potyviruses...
The CmSPI gene identified from Cucumis metuliferus encodes a serine type PI (8 kDa) that belongs to potato I type family. To ... Lin C-W, Su M-H, Lin Y-T, Chung C-H, Ku H-M. Functional Characterization of Cucumis metuliferus Proteinase Inhibitor Gene ( ... The CmSPI gene identified from Cucumis metuliferus encodes a serine type PI (8 kDa) that belongs to potato I type family. To ... Lin, C.-W.; Su, M.-H.; Lin, Y.-T.; Chung, C.-H.; Ku, H.-M. Functional Characterization of Cucumis metuliferus Proteinase ...
  http://www.mdpi.com/1999-4915/7/7/3816
*  Cucumis - Wikispecies
Genus: Cucumis Subgenera: C. subg. Cucumis - C. subg. Humifructus Species: C. aculeatus - C. aetheocarpus - C. africanus - C. ... Cucumis sativus L. Sp. Pl. 2: 1012 (1753). Note: The Australasian species above were unresolved on the Plant List (2014), but ... Schaefer, H. (2007) Cucumis (Cucurbitaceae) must include Cucumella, Dicoelospermum, Mukia, Myrmecosicyos, and Oreosyce: A ... Telford, I.R.H., Sebastian P.M., Bruhl J.J. & Renner S.S. (2011) Cucumis (Cucurbitaceae) in Australia and eastern Malesia, ...
  https://species.wikimedia.org/wiki/Cucumis
*  Cucumis - Wikipedia, a enciclopedia libre
Cucumis sativus (cogombro). Véxase tamén[editar , editar a fonte]. Ligazóns externas[editar , editar a fonte]. Wikispecies ... Cucumis é un xénero con 243 especies de plantas con flores pertencente á familia das Cucurbitáceas, que inclúe especies tan ... importantes coma o cogombro (Cucumis sativus) ou o meloeiro (Cucumis melo).. Especies seleccionadas[editar , editar a fonte]. * ... Traído desde "https://gl.wikipedia.org/w/index.php?title=Cucumis&oldid=4271483" ...
  https://gl.wikipedia.org/wiki/Cucumis
*  Map of Cucumis sativus -- Discover Life
... identification and distribution of Map of Cucumis sativus -- Discover Life ... Cucumis sativus @ American Museum of Natural History, Bee Specimen Record (1); Bernice P. Bishop Museum, Thematic Collection ...
  http://www.discoverlife.org/mp/20m?kind=Cucumis+sativus
*  Cucumis sativus ( Jazzer Cucumber ) | Backyard Gardener
'Jazzer' has a nice taste with no hint of the bitterness of some other varieties. Cucumbers are known space hogs in the garden, but can be managed quite ea
  https://www.backyardgardener.com/plantname/cucumis-sativus-jazzer-cucumber/
*  CUM10 - CUM10 - Cucumis sativus (Cucumber) - CUM10 gene & protein
Cucumis sativus (Cucumber). Cucumis melo (Muskmelon). Momordica charantia (Bitter gourd) (Balsam pear). Siraitia grosvenorii ( ... Cucumis sativus (Cucumber)Imported. ,p>Information which has been imported from another database using automatic procedures.,/p ... tr,O64959,O64959_CUCSA CUM10 OS=Cucumis sativus GN=CUM10 PE=2 SV=1 MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNN ...
  http://www.uniprot.org/uniprot/O64959
*  Cucumis melo agrestis Wild Melon PFAF Plant Database
Cucumis melo agrestis is a ANNUAL CLIMBER growing to 1.5 m (5ft). It is hardy to zone (UK) 10 and is frost tender. It is in ... Cucumis melo agrestis is a ANNUAL CLIMBER growing to 1.5 m (5ft). It is hardy to zone (UK) 10 and is frost tender. It is in ... The native habitat of Cucumis melo var agrestis is obscure but is presumably West Africa where the species occur wild and ... I believe the melon must be a variety of cucumis melo? Hope this info is useful to you. ...
  https://www.pfaf.org/user/Plant.aspx?LatinName=Cucumis+melo+agrestis
*  Cucumis melo ( New Charm Melon ) | Backyard Gardener
'New Charm' is generally ready for harvest 80 days after sowing. Oblong fruits are 2-3 pounds with lightly netted, ribbed rinds which are yellowish white w
  https://www.backyardgardener.com/plantname/cucumis-melo-new-charm-melon/
*  Photo of Cucumber (Cucumis sativus 'Straight Eight'): crab spider - Garden.org
Thread by robertduval14: forgot to put this in the photo description...but a close look at the lower left petal will reveal a small and well camouflaged c...
  https://garden.org/thread/view/15712/crab-spider/
*  Thrips Predator
Amblyseius cucumeris) is a small predatory mite that moves quickly to capture the egg and larval stages of various thrips ... A. cucumeris, like thrips themselves, are small (1/16 inch or less). These tan colored predatory mites are hard to spot. They ... The thrips predator (Amblyseius cucumeris) moves quickly to attack eggs, larvae and small adult thrips. Female thrips predators ...
  https://www.planetnatural.com/pest-problem-solver/beneficial-insects/thrips-predator/
*  Cucumis - Wikipedia
Cucumis melo, including cantaloupe and honeydew), the horned melon (Cucumis metuliferus), and the West Indian gherkin (Cucumis ... Cucumis is a genus of twining, tendril-bearing plants in the Cucurbitaceae family which includes the cucumber (Cucumis sativus ... Cucumis (Cucurbitaceae) in Australia and eastern Malesia, including newly recognized species and the sister species to C. melo ... Cucumber and melon have their wild progenitors in India, and the sister species of Cucumis melo is from Australia" Proceedings ...
  https://en.wikipedia.org/wiki/Cucumis
*  Melons: Cucumis melo 'Delicious 51'
plants related to Melons: Cucumis melo 'Delicious 51'. plants related to Melons: Cucumis melo 'Delicious 51'. * Cucumis melo ... Melons: Cucumis melo 'Delicious 51'. Botanical name: Cucumis melo 'Delicious 51'. Common name: muskmelon. ... description for "Melons: Cucumis melo 'Delicious 51'". An ideal melon for the home gardener is 'Delicious 51.' This oddly named ...
  http://www.digthedirt.com/plants/49051-melons-cucumis-melo-delicious-51
*  Cucumis argenteus - Wikipedia
Cucumis argenteus is a vine in the Cucurbitaceae family that is native to Western Australia through parts of the Pilbara and ... "Cucumis argenteus". FloraBase. Western Australian Government Department of Parks and Wildlife. ...
  https://en.wikipedia.org/wiki/Cucumis_argenteus
*  Cucumis variabilis - Wikipedia
Cucumis variabilis is a vine in the Cucurbitaceae family that is native to Western Australia throughout parts of the Kimberley ... "Cucumis variabilis". FloraBase. Western Australian Government Department of Parks and Wildlife. ...
  https://en.wikipedia.org/wiki/Cucumis_variabilis
*  Cucumis metuliferus - Wikipedia
Media related to Cucumis metuliferus at Wikimedia Commons Cucumis metuliferus in West African plants - A Photo Guide.. ... Cucumis metuliferus, horned melon or kiwano, also African horned cucumber or melon, jelly melon, hedged gourd, melano, is an ... "Cucumis metuliferus". PlantZAfrica.com. South African National Biodiversity Institute. Retrieved 7 June 2015. "Living - Kiwano ... Cucumis metuliferus)". www.herbgarden.co.za. Retrieved 2015-06-07. Elizabeth Schneider. Vegetables from Amaranth to Zucchini. ...
  https://en.wikipedia.org/wiki/Cucumis_metuliferus
*  Cucumis althaeoides - Wikipedia
Cucumis althaeoides is a vine in the Cucurbitaceae family that is native to Western Australia. Cucumis althaeoides is a ... The fruit of Cucumis altheoides are spherical, 8-18 mm (0.31-0.71 in) in diameter, and are a pale green with darker green ... Cucumis althaeoides is widespread across northern Australia. In Oxley Wild Rivers National Park, populations of C. althaeoides ... "Cucumis althaeoides". FloraBase. Western Australian Government Department of Parks and Wildlife. Dr. Mark Eldridge (2017) ...
  https://en.wikipedia.org/wiki/Cucumis_althaeoides
*  Cucumis myriocarpus - Wikipedia
Cucumis myriocarpus has many small fruit, hidden under the leaves. The fruit are smaller than a golf ball and green in colour, ... Cucumis myriocarpus (paddy melon) is often confused with Citrullus lanatus (the Afghan or camel melon) in Australia, where both ... Cucumis myriocarpus, the gooseberry cucumber, gooseberry gourd, paddy melon or prickly paddy melon is a prostrate or climbing ... "Cucumis myriocarpus". Natural Resources Conservation Service PLANTS Database. USDA. Retrieved 17 January 2016. Borger, John, " ...
  https://en.wikipedia.org/wiki/Cucumis_myriocarpus
*  Cucumis anguria - Wikipedia
Cucumis anguria was originally described and published in Species Plantarum 2: 1011. 1753. "Name - !Cucumis anguria L". ... "Profile for Cucumis anguria (West Indian gherkin)". PLANTS Database. USDA, NRCS. Retrieved November 4, 2012. "Cucumis anguria ... Cucumis anguria is primarily grown (as a crop plant) for its edible fruit, which are used in pickling, as cooked vegetables, or ... Cucumis anguria, commonly known as cackrey, maroon cucumber, West Indian gherkin, and West Indian gourd, is a vine that is ...
  https://en.wikipedia.org/wiki/Cucumis_anguria
*  Cymbium cucumis - Wikipedia
Cymbium cucumis, commonly known as the cucumber volute, is a species of sea snail, a marine gastropod mollusk in the family ... Cymbium cucumis Röding, 1798. Retrieved through: World Register of Marine Species on 25 April 2010.. ...
  https://en.wikipedia.org/wiki/Cymbium_cucumis
*  Beroe cucumis - Wikipedia
In 2012, Beroe cucumis was found off the coast of Israel for the first time, and there is proof that it preys on M. leidyi, as ... Beroe cucumis is a species of comb jelly in the family Beroidae. It is found in the Atlantic Ocean. It was first described by ... Beroe cucumis has a transparent, sac-like body, often somewhat compressed, and reaches a maximum length of about 15 cm (6 in). ... Beroe cucumis is found in the North Atlantic Ocean and the North Sea, including the Skagerrak and the Kattegat. It sometimes ...
  https://en.wikipedia.org/wiki/Beroe_cucumis
*  Cucumis humifructus - Wikipedia
Cucumis humifructus is thought to be the only Cucumis species having geocarpic (subterranean) fruit. The vines of the plant ... Cucumis humifructus, the aardvark cucumber or aardvark pumpkin, is a kind of cucumber from southern Africa, tropical Africa, ... "African Plant Database: Cucumis humifructus Stent". Conservatoire et Jardin botaniques & South African National Biodiversity ...
  https://en.wikipedia.org/wiki/Cucumis_humifructus
*  Macrocystidia cucumis - Wikipedia
"Macrocystidia cucumis March 2007". MushroomExpert.Com Web site. M. Kuo. Retrieved 2017-03-26. "Macrocystidia cucumis (Pers.) ... Macrocystidia cucumis in Index Fungorum Macrocystidia cucumis in MycoBank.. ... Macrocystidia cucumis was originally described in Europe where it is most common, and it is also known from North America, ... Macrocystidia cucumis is a common, inedible mushroom of the genus Macrocystidia, often found in large numbers on needle litter ...
  https://en.wikipedia.org/wiki/Macrocystidia_cucumis
*  Cucumis (website) - Wikipedia
Cucumis.org: Membership statistics Cucumis.org: Translation statistics Cucumis.org TechCrunch (blog) November 2006 review of ... One unusual feature of Cucumis is that all translations are peer reviewed and may be edited by other Cucumis translators. This ... Cucumis members are located in dozens of countries, with the two largest contingents in Turkey and Brazil; together, these two ... Founded in 2005, by July 2007 Cucumis had over 50,000 members and was receiving 100 requests per day for translations between ...
  https://en.wikipedia.org/wiki/Cucumis_(website)
*  PPT - Cucumber Cucumis sativus PowerPoint presentation | free to view - id: 1577d4-YjdhO
Cucumber Cucumis sativus. 1. Cucumber (Cucumis sativus)*Introduction *Both cucumbers and melons are members of the same genus ... Cucumis Sativus L. - Cucumis Sativus L. Nick Lorenz May 1, 2006 Phylogeny Interesting Facts Cucumbers originated in India where ... Cucumber (Cucumis sativus) - Cucumber (Cucumis sativus) Introduction Both cucumbers and melons are members of the same genus: ... Cucumber Cucumis sativus. Description:. Used for salads, fresh on sandwiches, uncooked in soups. Cucumber - types. Pickling ...
  http://www.powershow.com/view/1577d4-YjdhO/Cucumber_Cucumis_sativus_powerpoint_ppt_presentation