Loading...


*  NewEast Biosciences
Briefly, anti-active Ral mouse monoclonal antibody will be incubated with cell lysates containing Ral-GTP. The bound active Ral ... The Ras-like small G proteins, RalA/B, are important components of Ras signaling pathways, implicated in the initiation and ... These anti-Ral-GTP monoclonal antibodies can also be used to monitor the activation of Ral in cells and in tissues by ... RalB Activation Assay Kit bases on the configuration-specific anti-Ral-GTP monoclonal antibody to measure the active Ral-GTP ...
  http://www.neweastbio.com/Ra1Assay.do
*  RALBP1抗体|Abcam中国|Anti-RALBP1抗体(ab33446)
Ral-interacting protein 1, 76-KD antibody. *RalA-binding protein 1 antibody ... Can activate specifically hydrolysis of GTP bound to RAC1 and CDC42, but not RALA. Mediates ATP-dependent transport of S-(2,4- ... Serves as a scaffold protein that brings together proteins forming an endocytotic complex during interphase and also with CDK1 ... 1%BSA / 10% normal goat serum / 0.3M glycine was used to quench autofluorescence and block non-specific protein-protein ...
  http://www.abcam.cn/ralbp1-antibody-ab33446.html
*  RALA - Wikipedia
"Identification and characterization of a calmodulin-binding domain in Ral-A, a Ras-related GTP-binding protein purified from ... "Identification and characterization of a novel protein interacting with Ral-binding protein 1, a putative effector protein of ... "Identification and characterization of a novel protein interacting with Ral-binding protein 1, a putative effector protein of ... Wang KL, Roufogalis BD (May 1999). "Ca2+/calmodulin stimulates GTP binding to the ras-related protein ral-A". The Journal of ...
  https://en.wikipedia.org/wiki/RALA
*  RALA - Ras-related protein Ral-A precursor - Homo sapiens (Human) - RALA gene & protein
Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. The RALA-exocyst complex regulates integrin-dependent ... Key regulator of LPAR1 signaling and competes with GRK2 for binding to LPAR1 thus affecting the signaling properties of the ... View protein in InterPro. IPR027417. P-loop_NTPase. IPR028412. Ral. IPR005225. Small_GTP-bd_dom. IPR001806. Small_GTPase. ... View protein in InterPro. IPR027417. P-loop_NTPase. IPR028412. Ral. IPR005225. Small_GTP-bd_dom. IPR001806. Small_GTPase. ...
  http://www.uniprot.org/uniprot/P11233
*  CDK5 | Cancer Genetics Web
ral GTP-Binding Proteins. *Oligonucleotide Array Sequence Analysis. *Cell Survival. *Drug Resistance ... protein autophosphorylation - protein binding - protein kinase activity - protein localization to synapse - protein serine/ ... positive regulation of protein binding - positive regulation of protein kinase activity - positive regulation of protein ... These RNA-binding proteins (RBPs) were shown to oppositely control CDK5R1 mRNA stability and p35 protein content at post- ...
  http://www.cancerindex.org/geneweb/CDK5.htm
*  Protein interactions and ligand binding: From protein subfamilies to functional specificity | PNAS
1999) Effector recognition by the small GTP-binding proteins Ras and Ral. J Biol Chem 274(25):17763-17770. ... Protein interactions and ligand binding: From protein subfamilies to functional specificity. Antonio Rausell, David Juan, ... Protein interactions and ligand binding: From protein subfamilies to functional specificity. Antonio Rausell, David Juan, ... Protein interactions and ligand binding: From protein subfamilies to functional specificity Message Subject (Your Name) has ...
  http://www.pnas.org/content/107/5/1995
*  Plus it
... binds to Ral guanine nucleotide exchange factors (RalGEFs) that activate RalGTPase. RalBP1, one of the Ral GTP-binding proteins ... Scaffolding proteins and actin-binding proteins typically interact with ion channels through conserved, modular protein domains ... Witzgall and co-workers (26) identified Hax-1, a cortactin-binding protein, as a protein interacting with a region between ... The proteins forming the motor protein/actin-regulatory protein complex that facilitate in the intracellular trafficking of ...
  http://ajprenal.physiology.org/content/291/6/F1113
*  anti-V-Ral Simian Leukemia Viral Oncogene Homolog B (Ras Related, GTP Binding Protein) (Ralb) Antikörper</span>
... ras-related protein Ral-B , v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) , GTP binding ... This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding ... anti-V-Ral Simian Leukemia Viral Oncogene Homolog B (Ras Related, GTP Binding Protein) Antikörper (Ralb). Auf www.antikoerper- ... Mouse (Murine) V-Ral Simian Leukemia Viral Oncogene Homolog B (Ras Related, GTP Binding Protein) (Ralb) Interaktionspartner ...
  http://www.antikoerper-online.de/neurotrophin-signal%C3%BCbertragung-pathway-29/ralb-antibody-18580/
*  ralb, v-ral simian leukemia viral oncogene homolog B - Creative Biogene
GTP binding protein); ras-related protein Ral-B; RAS-like protein B; GTP binding protein ... By binding to various effector proteins, RalA and RalB serve as important GTP sensors ... RalA and RalB are members of the Ras family of small GTPases and are highly homologous in protein sequence. The functions of ... RALB; v-ral simian leukemia viral oncogene homolog B (ras related; ...
  https://www.creative-biogene.com/symbolsearch_ralb.html
*  KEGG T01010: 399470
GTP binding protein) (A) MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG ... xla:399470 K07827 GTPase KRas , (RefSeq) ralb, KRAS2, k-ras, xralb; v-ral simian leukemia viral oncogene homolog B (ras related ...
  http://www.genome.jp/dbget-bin/www_bget?-f+-n+a+xla:399470
*  Identification and proteomic profiling of exosomes in human urine | PNAS
The LC-MS/MS analysis identified multiple small GTP-binding proteins, including proteins in the Rab, ARF, Rho, and Ral families ... including apical plasma membrane proteins and cytosolic proteins. In contrast, the analysis identified few proteins associated ... Protein classification is based on analysis by using a harvester search. Protein classes are color-coded to correspond to Table ... Ubiquitinated proteins are endocytosed and sorted in the endosomal pathway by a process dependent on adaptor proteins that ...
  http://www.pnas.org/content/101/36/13368
*  KEGG SSDB Paralog Search Result: xla:399470
v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein); K07827 GTPase KRas. ... xla:108712412 GTP-binding protein Di-Ras1 K07840 198 453 ( -) 109 0.389 193 -, xla:108706836 GTP-binding protein Di-Ras1-like ... xla:108707001 GTP-binding protein Di-Ras2-like K07841 199 406 ( -) 98 0.371 194 -, xla:495976 DIRAS family, GTP-binding RAS- ... 108716422 rho-related GTP-binding protein RhoQ-like K07194 205 264 ( -) 66 0.323 167 -, xla:108717736 rho-related GTP-binding ...
  http://www.kegg.jp/ssdb-bin/ssdb_paralog?org_gene=xla:399470
*  Superfamily of monomeric GTP-binding proteins in plants: 1. Role of rop proteins in the control of plant growth and development...
Role of rop proteins in the control of plant growth and development, Russian Journal of Plant Physiology" on DeepDyve, the ... "Superfamily of monomeric GTP-binding proteins in plants: 1. ... RalBP1-Ral-binding protein 1; RalGDS-Ral GDP dissocia-. tion ... Superfamily of monomeric GTP-binding proteins in plants: 1. Role of rop proteins in the control... Novikova, G.; Moshkov, I. ... Superfamily of monomeric GTP-binding proteins in plants: 1. Role of rop proteins in the control of plant growth and development ...
  https://www.deepdyve.com/lp/springer_journal/superfamily-of-monomeric-gtp-binding-proteins-in-plants-1-role-of-rop-bJUCGEA0QQ
*  RAB11B Gene - GeneCards | RB11B Protein | RB11B Antibody
Protein Coding), RAB11B, Member RAS Oncogene Family, including: function, proteins, disorders, pathways, orthologs, and ... The Ras superfamily of small GTP-binding proteins, which includes the Ras (see MIM 190020), Ral (see MIM 179550), Rho (see MIM ... Molecular cloning of two small GTP-binding proteins from human skeletal muscle. (PMID: 7811277) Zhu AX … Flier JS (Biochemical ... Protein Symbol:. Q15907-RB11B_HUMAN. Recommended name:. Ras-related protein Rab-11B Protein Accession:. Q15907. Secondary ...
  http://www.genecards.org/cgi-bin/carddisp.pl?gene=RAB11B
*  RALB - Wikipedia
RALB v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein)". Simicek M, Lievens S, Laga M, Guzenko ... "Identification and characterization of a novel protein interacting with Ral-binding protein 1, a putative effector protein of ... Ras-related protein Ral-B (RalB) is a protein that in humans is encoded by the RALB gene on chromosome 2. This protein is one ... Hsieh CL, Swaroop A, Francke U (1990). "Chromosomal localization and cDNA sequence of human ralB, a GTP binding protein". Somat ...
  https://en.wikipedia.org/wiki/RALB
*  Cellular functions of the Rap1 GTP-binding protein: a pattern emerges | Journal of Cell Science
Ral and Rap groups. The Rap subgroup contains two pairs of quasi-identical GTP-binding proteins (Rap1A and Rap1B; and Rap2A and ... Small GTP-binding proteins. Introduction. The Ras superfamily of GTP-binding proteins comprises over 100 members, all ... Active, GTP-bound Ras proteins interact with specific downstream effectors, that is, signalling or structural proteins that are ... Small GTP-binding proteins are generally grouped into five subfamilies of structurally and functionally related proteins named ...
  http://jcs.biologists.org/content/116/3/435
*  RCSB PDB - 1GUA: HUMAN RAP1A, RESIDUES 1-167, DOUBLE MUTANT (E30D,K31E) COMPLEXED WITH GPPNHP AND THE RAS-BINDING-DOMAIN OF...
COMPLEXED WITH GPPNHP AND THE RAS-BINDING-DOMAIN OF HUMAN C-RAF1, RESIDUES 51-131 ... Members of the Ras subfamily of small GTP-binding proteins have been shown to be promiscuous towards a variety of putative ... effector molecules such as the protein kinase c-Raf and the Ral-specific guanine nucleotide exchange factor (Ral-GEF). To addre ... Members of the Ras subfamily of small GTP-binding proteins have been shown to be promiscuous towards a variety of putative ...
  https://www.rcsb.org/structure/1GUA
*  The GDP Exchange Factor AND-34 Is Expressed in B Cells, Associates With HEF1, and Activates Cdc42 | The Journal of Immunology
Ral), respectively. After isolation of the GST-chimeric proteins the GTP-bound GTPases were eluted from the beads and ... Regulation of the small GTP-binding protein Rho by cell adhesion and the cytoskeleton. EMBO J. 18: 578. ... Again, treatment of WEHI-231 cells with GTP-γ-S demonstrated the ability of the assay to detect endogenous GTP-bound RalA and ... Ras and Rho subfamily GTPases alternate between inactive GDP-bound and active GTP-bound conformations. The ratio of GTPases in ...
  http://www.jimmunol.org/content/170/2/969?ijkey=5e163188919689daab370c4d49dd15de6a53e605&keytype2=tf_ipsecsha
*  Intrabodies based on intracellular capture frameworks that bind the RAS protein with high affinity and impair oncogenic...
RAS is a membrane‐bound GTP/GDP‐binding G protein that serves as a molecular switch, converting signal transduction from the ... binding proteins H‐Ras, Rap1A and R‐Ras with the putative effector molecules Raf kinase and Ral‐guanine nucleotide exchange ... 1988) Protein engineering of antibody binding sites: recovery of specific activity in an anti‐digoxin single‐chain Fv analogue ... The affinities of binding of anti‐RAS scFvs to antigen were measured by binding kinetics in the BIAcore (Figure 6). The Kds of ...
  http://emboj.embopress.org/content/22/5/1025
*  THU0021 Defective rap1 activation in synovial fluid t lymphocytes from patients with rheumatoid arthritis | Annals of the...
GTP-bound Rap1 was precipitated using the bacterial expressed fusion protein GST-RalGDS and detected by ECL Western blotting. ... whole cell lysates were prepared in Ral lysis buffer. ... Background Rap1 is a small G-protein, member of the Ras GTPase ... The defective Rap1 activation was not due to increased levels of the Rap1 GTPase activating proteins RapGAP or spa1. While ... This defective activation is not due to increased levels of the Rap1 GTPase activating proteins RapGAP or Spa1. ...
  http://ard.bmj.com/content/60/Suppl_1/A211.3
*  Plus it
In the activated, GTP-bound state, RAS binds to and activates multiple effector proteins of which more than 10 have been ... protein families and Ral guanine dissociation stimulator (5-8). Early work focused on the RAF family of serine/threonine ... Complexes of Ras GTP with Raf-1 and mitogen-activated protein kinase kinase. Science 1993;260:1658-61. ... protein kinases. RAS-GTP binds to and activates the three RAF kinase family members which phosphorylate their main substrates, ...
  http://cancerres.aacrjournals.org/content/70/17/6804
*  KEGG PATHWAY: Ras signaling pathway - Homo sapiens (human)
Ras proteins transduce signals from extracellular growth factors by cycling between inactive GDP-bound and active GTP-bound ... RAS-GTP) regulates multiple cellular functions through effectors including Raf, phosphatidylinositol 3-kinase (PI3K) and Ral ... The exchange of GTP for GDP on RAS is regulated by guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins ( ... The Ras proteins are GTPases that function as molecular switches for signaling pathways regulating cell proliferation, survival ...
  http://www.genome.jp/kegg-bin/show_pathway?hsa04014+5594+5869
*  The rap Protein Family: rap1A, rap1B, rap2A, and rap2B | SpringerLink
Rap proteins, like ras, are low molecular weight... ... Rap proteins were discovered and identified within the last ... Rap proteins, like ras, are low molecular weight GTP-binding proteins. They share 50% homology to ras and are expressed in a ... The rap proteins are members of a larger family of proteins homologous to ras including ral, rho, rac, and rab, which has been ... Lapetina E.G., Campa M.J., Winegar D.A., Farrell F.X. (1991) The rap Protein Family: rap1A, rap1B, rap2A, and rap2B. In: ...
  https://link.springer.com/chapter/10.1007/978-1-4684-6018-6_32
*  IMP: Integrative Multi-species Prediction
v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein). 0.043. ... Any process that stops, prevents, or reduces the frequency, rate or extent of signaling via the stress-activated protein kinase ... Highlight genes with functional analogs involved in "negative regulation of stress activated protein kinase signaling cascade" ... negative regulation of stress activated protein kinase signaling cascade. GO:0070303. ...
  http://imp.princeton.edu/predictions/process/human-context-global/3426/?gene=10879