*  A Xenopus Laevis Research Resource for Immunobiology - Jacques Robert
Xenopus laevis is one of the best ectothermic vertebrate models for studying the phylogeny and ontogeny of the immune system. ... A Xenopus Laevis Research Resource for Immunobiology Robert, Jacques University of Rochester, Rochester, NY, United States ... Xenopus laevis is one of the best ectothermic vertebrate models for studying the phylogeny and ontogeny of the immune system. ... The overall objective of this renewal application is to safeguard and promote the frog Xenopus laevis, as an important non- ...
  http://grantome.com/grant/NIH/R24-AI059830-09
*  Difference between revisions of "Xenopus Genome Project" - Marcotte Lab
Xenopus laevis is an essential model organism in several areas of biology. In addition to the key attributes of these embryos ... X_laevis_WG - the X. laevis whole genome library, 5kb insert size - about 4.4GB raw data, 0.4GB high quality data. ... Given that we currently see better mapping of the shotgun SA09023 reads to X. tropicalis than to X. laevis (both to BACs and ... X_laevis_2kb - The set of 96 BACs, with 2kb insert size - about 3.6GB raw data, 0.3GB high quality data. ...
  http://www.marcottelab.org/index.php?title=Xenopus_Genome_Project&diff=1536&oldid=1523
*  AID 630202 - Inhibition of retinal rod CNGA1/CNGB1 expressed in Xenopus laevis oocytes assessed as blockade of cGMP-induced...
Inhibition of retinal rod CNGA1/CNGB1 expressed in Xenopus laevis oocytes assessed as blockade of cGMP-induced current at +50 ...
  https://pubchem.ncbi.nlm.nih.gov/bioassay/630202
*  Xenopus Genome Project - Marcotte Lab
Xenopus laevis is an essential model organism in several areas of biology. In addition to the key attributes of these embryos ... X_laevis_WG - the X. laevis whole genome library, 5kb insert size - about 4.4GB raw data, 0.4GB high quality data. ... Given that we currently see better mapping of the shotgun SA09023 reads to X. tropicalis than to X. laevis (both to BACs and ... 1 Assembled transcripts from J-strain X. laevis RNA-seq data (190,591) *1.1 J-strain stage data (78,546) ...
  http://www.marcottelab.org/index.php?title=Xenopus_Genome_Project&oldid=1495
*  Some bio-electric parameters of early Xenopus embryos | Development
Membrane potential and resistance were measured in eggs, cleavage stages and blastulae of the South African toad Xenopus laevis ...
  http://dev.biologists.org/content/24/3/535
*  Difference between revisions of "Xenopus Genome Project" - Marcotte Lab
Xenopus laevis is an essential model organism in several areas of biology (see Harland & Grainger, TIG (2011) for review). In ... Xenopus laevis'' is an essential model organism in several areas of biology. In addition to the key attributes of these embryos ... Xenopus laevis - http://daudin.icmb.utexas.edu/XENLA_JGIv72/ * Xenopus tropicalis - http://daudin.icmb.utexas.edu/XENTR_JGIv80/ ... Xenopus laevis - http://gbrowse.xenbase.org/fgb2/gbrowse/xl7_1/ * Xenopus tropicalis - http://gbrowse.xenbase.org/fgb2/gbrowse/ ...
  http://www.marcottelab.org/index.php?title=Xenopus_Genome_Project&diff=1843&oldid=1537
*  Gautier Lab:Xenopus resources - OpenWetWare
Female Xenopus can be induced to lay an abundance of eggs after hormone injection. In fact, Xenopus laevis were used as a ... Xenopus resources. In our laboratory, we use Xenopus laevis, commonly known as the African clawed frog (learn more on wikipedia ... Xenopus laevis is a great model system for dissecting the molecular pathways in DNA replication and the maintenance of genomic ... In addition to being used to generate cell-free extracts, Xenopus oocytes and eggs can also be studying directly. Xenopus eggs ...
  https://openwetware.org/wiki/Gautier_Lab:Xenopus_resources
*  Differential muscle regulatory factor gene expression between larval and adult myogenesis in the frog Xenopus laevis: adult...
During Xenopus laevis metamorphosis, larval-to-adult muscle conversion depends on the differential responses of adult and ... Making muscle: Morphogenetic movements and molecular mechanisms of myogenesis in Xenopus laevis.. *Armbien Sabillo. , Julio ... Insulin-like growth factor 1 regulation of proliferation and differentiation of Xenopus laevis myogenic cells in vitro. *Sairi ... During Xenopus laevis metamorphosis, larval-to-adult muscle conversion depends on the differential responses of adult and ...
  https://www.semanticscholar.org/paper/Differential-muscle-regulatory-factor-gene-express-Yamane-Nishikawa/b36d7bed0d30b219546d44cd5955cd4a927ce047
*  Xenopus Genome Project - Marcotte Lab
Xenopus laevis is an essential model organism in several areas of biology (see Harland & Grainger, TIG (2011) for review). In ... X_laevis_WG - the X. laevis whole genome library, 5kb insert size - about 4.4GB raw data, 0.4GB high quality data. ... Given that we currently see better mapping of the shotgun SA09023 reads to X. tropicalis than to X. laevis (both to BACs and ... X_laevis_2kb - The set of 96 BACs, with 2kb insert size - about 3.6GB raw data, 0.3GB high quality data. ...
  http://www.marcottelab.org/index.php?title=Xenopus_Genome_Project&oldid=1541
*  JAIRO | In vivo tracking of histone H3 lysine 9 acetylation in Xenopus laevis during tail regeneration
9 acetylation in Xenopus laevis during tail regenerationIn vivo tracking of histone H3 lysine 9 acetylation in Xenopus laevis ... In vivo tracking of histone H3 lysine 9 acetylation in Xenopus laevis during tail regeneration. ...
  http://jairo.nii.ac.jp/0083/00238503/en
*  AID 700514 - Modulation of human recombinant GABA-A alpha1beta1gamma2L receptor expressed in Xenopus laevis oocytes assessed as...
Modulation of human recombinant GABA-A alpha1beta1gamma2L receptor expressed in Xenopus laevis oocytes assessed as effect on ...
  https://pubchem.ncbi.nlm.nih.gov/bioassay/700514
*  Plus it
Oocytes were surgically removed from mature Xenopus laevis frogs (Nasco, Fort Atkinson, WI). The care and use of X. laevis ... laevis oocytes express a Ca2+-activated Cl- channel that can contribute to whole-cell current responses when Ca2+ permeable ... laevis oocytes. For this reason, we have chosen not to attempt to inhibit the Ca2+-activated Cl- channel. ... laevis oocytes with wild-type β4 or α4 subunits, respectively. ACh dose-response curves, constructed for each mutant receptor, ...
  http://molpharm.aspetjournals.org/content/69/1/27
*  Container of African Clawed Frogs (Xenopus Laevis Poster
Xenopus Laevis Posters & Prints in all sizes. 1000s of designs & options available, or custom create your own! ... Container of African Clawed Frogs (Xenopus Laevis Poster. Add to Favorites Add to List Add to List ... Container of African Clawed Frogs (Xenopus Laevis Pricing By Style and Size. Poster. Wall Decal. Mounted Print. Canvas Art. ... Interests: Styles And Patterns , Design Themes , Colors , Black , Black Background , Container of African Clawed Frogs (Xenopus ...
  http://www.cafepress.com/+container_of_african_clawed_frogs_xenopus_laevis_large_poster,841759060
*  RING finger protein - Xenopus laevis (African clawed frog)
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). Xenopus laevis (African clawed frog). Nanorana parkeri. 526. ... Xenopus laevis (African clawed frog)Imported. ,p>Information which has been imported from another database using automatic ... Xenopus laevis (African clawed frog). 518. UniRef90_Q6NUE7. Cluster: LOC397846 protein. 2. ... tr,Q91884,Q91884_XENLA RING finger protein OS=Xenopus laevis PE=2 SV=1 ...
  http://www.uniprot.org/uniprot/Q91884
*  Xenopus Laevis: Frog Antibody Reactivity | Cell Signaling
Visit CellSignal.com to view our Xenopus Laevismaterials including Frog Antibody Reactivity & more. CST - Customer satisfaction ... Species Reactivity: Xenopus Model Organism: Xenopus laevis (frog). The products listed below have been validated for use with ... Xenopus samples. If there is another antibody you are interested in using for this model organism, please contact our technical ...
  https://www.cellsignal.com/browse/xenopus?N=4294960394+4294956287
*  Purification of the MeCP2/Histone Deacetylase Complex from Xenopus laevis | SpringerLink
Jones P.L., Wade P.A., Wolffe A.P. (2002) Purification of the MeCP2/Histone Deacetylase Complex from Xenopus laevis. In: Ward A ... Here, we describe techniques for purifying the MeCP2-contining histone deacetylase complex from Xenopus laevis oocytes. ... A multiple subunit Mi-2 histone deacetylase from Xenopus laevis cofractionates with an associated Snf2 superfamily ATPase. Curr ... Shimamura, A.and Worcel, A. (1989) The assembly of regularly spaced nucleosomes in the Xenopus oocyte S-150 extract is ...
  https://link.springer.com/protocol/10.1385/1-59259-211-2:297
*  Figure 4.8, [A clone of Xenopus laevis...]. - Developmental Biology - NCBI Bookshelf
A clone of Xenopus laevis frogs. The nuclei for all the members of this clone came from a single individual-a female tailbud- ... A clone of Xenopus laevis frogs. The nuclei for all the members of this clone came from a single individual-a female tailbud- ...
  https://www.ncbi.nlm.nih.gov/books/NBK10131/figure/A554/?report=objectonly
*  Cold Spring Harbor Lab Press Xenopus laevis
Manipulating the Early Embryo of Xenopus laevis: A Video Guide. Edited By Robert M. Grainger, University of Virginia, ... Early Development of Xenopus laevis: A Laboratory Manual. By Hazel L. Sive, Whitehead Institute for Biomedical Research; Robert ...
  https://www.cshlpress.com/default.tpl?cart=130520132853361399&id1=107&startat=1&--woSECTIONSdatarq=107&--SECTIONSword=ww&sortby_1=recency
*  tnfrsf12a - Fn14 - Xenopus laevis (African clawed frog) - tnfrsf12a gene & protein
Xenopus laevis (African clawed frog). Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). 120. UniRef50_Q6SIX7. ... Xenopus laevis (African clawed frog)Imported. ,p>Information which has been imported from another database using automatic ... tr,Q6SIX7,Q6SIX7_XENLA Fn14 OS=Xenopus laevis OX=8355 GN=tnfrsf12a PE=1 SV=1 ...
  http://www.uniprot.org/uniprot/Q6SIX7
*  nbn - Nibrin - Xenopus laevis (African clawed frog) - nbn gene & protein
Xenopus laevis (African clawed frog). Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). 763. UniRef50_Q6XV80. ... Xenopus laevis (African clawed frog)Imported. ,p>Information which has been imported from another database using automatic ... tr,Q6XV80,Q6XV80_XENLA Nibrin OS=Xenopus laevis GN=nbn PE=1 SV=1 MWRLVAESAAGGTYHFLTGTDYVVGRKNCAILIPEDQSISRCHATLSVSHPSANLGQTNA ...
  http://www.uniprot.org/uniprot/Q6XV80
*  gucy2c - Guanylate cyclase - Xenopus laevis (African clawed frog) - gucy2c gene & protein
Xenopus laevis (African clawed frog)Imported. ,p>Information which has been imported from another database using automatic ... tr,P79991,P79991_XENLA Guanylate cyclase OS=Xenopus laevis GN=gucy2c PE=2 SV=1 ...
  http://www.uniprot.org/uniprot/P79991
*  The glomus cell of the carotid labyrinth of Xenopus laevis.
Xenopus laevis. These cells show many catecholamine containing granules. About 50 cells in groups of 3-5 are located near the ... The ultrastructure of the glomus cells of the carotid labyrinth was investigated in the anuran, Xenopus laevis. These cells ...
  http://www.biomedsearch.com/nih/glomus-cell-carotid-labyrinth-Xenopus/7105145.html
*  Biochemical changes in developmentally retarded Xenopus laevis larvae | Development
Biochemical changes in developmentally retarded Xenopus laevis larvae Message Subject (Your Name) has sent you a message from ... Premetamorphic tadpoles of Xenopus laevis reared in water containing 0·01% propylthiouracil are developmentally retarded and ...
  http://dev.biologists.org/content/46/1/215
*  African clawed frog (Xenopus laevis) longevity, ageing, and life history
Genus: Xenopus. Species. Xenopus laevis. Common name. African clawed frog. Lifespan, ageing, and relevant traits. Maximum ... 2017), The African clawed frog Xenopus laevis: A model organism to study regeneration of the central nervous system (PubMed) ... AnAge entry for Xenopus laevis Classification (HAGRID: 00085). Taxonomy. Kingdom: Animalia. Phylum: Chordata. Class: Amphibia ( ... 0010] Brocas and Verzar (1961), The aging of Xenopus laevis, a South African frog (PubMed) ...
  http://genomics.senescence.info/species/entry.php?species=Xenopus_laevis
*  Xenbase Clone: Summary for P014 [species: Xenopus laevis]
Xenbase: The Xenopus laevis and X. tropicalis resource.. Version: 4.9.2 © Xenbase 2005-Tue Aug 14 00:25:17 MDT 2018 ... External Dbs: Unigene laevis cDNA library. Description: A subtracted cDNA library was made from corneas undergoing ...
  http://www.xenbase.org/geneExpression/showclone.do?method=displayCloneSummary&cloneId=1619310