*  Reexpression of uridine monophosphate kinase activity restores sensitivity to pulse 5FU resistant colorectal cancer cells |...
Reexpression of uridine monophosphate kinase activity restores sensitivity to pulse 5FU resistant colorectal cancer cells. Rita ... Reexpression of uridine monophosphate kinase activity restores sensitivity to pulse 5FU resistant colorectal cancer cells ... Reexpression of uridine monophosphate kinase activity restores sensitivity to pulse 5FU resistant colorectal cancer cells ... Reexpression of uridine monophosphate kinase activity restores sensitivity to pulse 5FU resistant colorectal cancer cells ...
  http://cancerres.aacrjournals.org/content/65/9_Supplement/776.2
*  TIGR01091
... uridine kinases, and other, uncharacterized proteins. ...
  http://www.jcvi.org/cgi-bin/tigrfams/HmmReportPage.cgi?acc=TIGR01091
*  Search Results
Cog name: Uridine kinase/panthothenate kinase. Functional class: F/H. BeTs to -hg-c-y-. Number of proteins in this genome ... uridine kinase. Gene Start:. 378714. Gene Stop:. 378091. Gene Length:. 624. Molecular Weight*:. 24162. pI*:. 9.10. Net Charge*: ... Residues 8-126 are 37% similar to a uridine kinase domain as seen in URK_MYCGE. Residues 131-199 are 52% similar to a udk ... Several hits in gapped BLAST to uridine kinase sequences, e.g. residues 4-206 are 41% similar to the enzyme from B.subtilis ( ...
  http://stdgen.northwestern.edu/cgi-bin/gene_id_search.cgi?dbname=uure&gene_id=UU332
*  "Specific activities of uridine kinase and uridine phosphorylase of ehr" by D G. Blair and D J. Rainnie
Specific activities of uridine kinase and uridine phosphorylase of ehrlich ascites carcinoma cells during tumor growth. Abstr. ... Blair, D G. and Rainnie, D J., "Specific activities of uridine kinase and uridine phosphorylase of ehrlich ascites carcinoma ...
  http://mouseion.jax.org/ssbb1969/23/
*  What does uridine kinase mean?
Meaning of uridine kinase. What does uridine kinase mean? Information and translations of uridine kinase in the most ... Definition of uridine kinase in the Definitions.net dictionary. ... Search for uridine kinase on Amazon. *Search for uridine kinase ... Other names in common use include pyrimidine ribonucleoside kinase, uridine-cytidine kinase, uridine kinase, and uridine ... What does uridine kinase mean?. Definitions for uridine kinase. Here are all the possible meanings and translations of the word ...
  https://www.definitions.net/definition/uridine%20kinase
*  Uridine kinase - Wikipedia
Other names in common use include pyrimidine ribonucleoside kinase, uridine-cytidine kinase, uridine kinase (phosphorylating), ... In enzymology, an uridine kinase (EC 2.7.1.48) is an enzyme that catalyzes the chemical reaction ATP + uridine ⇌ {\displaystyle ... Uridine-cytidine kinase of Novikoff ascites rat tumor". J. Biol. Chem. 244 (8): 2204-9. PMID 5782006. Skold O (1960). "Uridine ... The systematic name of this enzyme class is ATP:uridine 5'-phosphotransferase. ...
  https://en.wikipedia.org/wiki/Uridine_kinase
*  Search: All Pfam signatures | InterPro | EMBL-EBI
Phosphoribulokinase/uridine kinase (IPR006083) Pfam signature: PF00485 OmpR/PhoB-type DNA-binding domain (IPR001867) Pfam ... GHMP kinase N-terminal domain (IPR006204) Pfam signature: PF00288 Biotin carboxylase-like, N-terminal domain (IPR005481) Pfam ... 6-phosphofructo-2-kinase (IPR013079) Pfam signature: PF01591 NIF system FeS cluster assembly, NifU, N-terminal (IPR002871) Pfam ... Casein kinase II, regulatory subunit (IPR000704) Pfam signature: PF01214 Cytochrome c oxidase, subunit Vb (IPR002124) Pfam ...
  http://www.ebi.ac.uk/interpro/member-database/Pfam
*  UniProt/TrEMBL: A7S545 NEMVE
DR GO; GO:0004849; F:uridine kinase activity; IBA:GO_Central. DR GO; GO:0006206; P:pyrimidine nucleobase metabolic process; IBA ... DR InterPro; IPR000764; Uridine_kinase-like. DR Pfam; PF00485; PRK; 2. DR SUPFAM; SSF52540; SSF52540; 2. DR SUPFAM; SSF53271; ...
  http://www.genome.jp/dbget-bin/www_bget?tr:A7S545_NEMVE
*  Cytidine - DrugBank
Uridine kinase activity. Specific Function. Phosphorylates uridine and cytidine to uridine monophosphate and cytidine ... UUridine-cytidine kinase 2. Not Available. Human. Absorption. Not Available. Volume of distribution. Not Available. Protein ...
  https://www.drugbank.ca/drugs/DB02097
*  Targeting Purine and Pyrimidine Metabolism in Human Apicomplexan Parasites
... a bifunctional protein with UPRT and uridine kinase (UK; EC 2.7.1.48) activities, and thymidine kinase (TK; EC 2.7.1.21), Fig ... UK enzymes are capable of processing cytidine as well as uridine, and C. parvum, unlike T. gondii, is susceptible to cytosine- ... It was recently shown that substituted uridines can be successfully incorporated into the RNA of T. gondii itself or of human ... De novo and salvage pathways to uridine 5′-monophosphate, the precursor of other pyrimidine nucleotides. P,T,C indicate that ...
  http://pubmedcentralcanada.ca/pmcc/articles/PMC2720675/
*  Phylogenomic evidence supports past endosymbiosis, intracellular and horizontal gene transfer in Cryptosporidium parvum |...
In other cases, such as pyruvate kinase and the bi-functional dehydrogenase enzyme (AdhE), gene trees obtained from automated ... calcium-dependent protein kinase; (f) dihydrofolate reductase-thymidine synthetase (DHFR-TS). The genes examined in (a-c, e) ... thymidine kinase (TK), is of α or γ-proteobacterial ancestry [25]. ... thymidine kinase), trpB and the gene for aspartate ammonia ligase). ...
  https://genomebiology.biomedcentral.com/articles/10.1186/gb-2004-5-11-r88
*  Table of Contents - August 01, 1973, 133 (4) | Biochemical Journal
Uridine kinase in embryonic rat liver. Modulation of enzyme activity by 5-azacytidine J. Veselý, A. Čihák ...
  http://www.biochemj.org/content/133/4
*  DAS2 (YDR020C) Result Summary | BioGRID
Weak Similarity With Uridine Kinases And With Phosphoribokinases ... RRT3, putative uridine kinase DAS2, YDR020C. Putative protein ... weak similarity with uridine kinases and with phosphoribokinases ...
  https://thebiogrid.org/32070/table/saccharomyces-cerevisiae/das2.html
*  Pyrimidine Metabolism in Rat Brain Cortex and Liver | SpringerLink
... uridine kinase and uridine phosphorylase.. Keywords. Brain Cortex Salvage Pathway Orotic Acid Considerable Activity Pyrimidine ... A considerable activity of uridine kinase is present in brain (6,7). OA and uracil can not pass the blood-brain barrier (8), ... but uridine can be taken up (9). In this study we com-pare the de novo and salvage pathways by measuring the incorporation of ...
  https://link.springer.com/chapter/10.1007/978-1-4684-4553-4_102
*  CMPK2 Gene - GeneCards | CMPK2 Protein | CMPK2 Antibody
Cytidine/Uridine Monophosphate Kinase 2, including: function, proteins, disorders, pathways, orthologs, and expression. ... CMPK2 (Cytidine/Uridine Monophosphate Kinase 2) is a Protein Coding gene. Among its related pathways are superpathway of ... Human UMP-CMP kinase 2, a novel nucleoside monophosphate kinase localized in mitochondria. (PMID: 17999954) Xu Y … Karlsson A ( ... The human adenylate kinase 9 is a nucleoside mono- and diphosphate kinase. (PMID: 23416111) Amiri M … Solaroli N (The ...
  https://www.genecards.org/cgi-bin/carddisp.pl?gene=CMPK2
*  UCK2 Human | ProSpec
UK, UCK 2, Uridine-Cytidine Kinase 2, Uridine Monophosphate Kinase, Cytidine Monophosphokinase 2. ... UCK2 is a member of the uridinekinase family. UCK2 catalyzes the phosphorylation of uridine monophosphate to uridine ...
  https://www.prospecbio.com/UCK2_Human
*  FFAS03 results for 13507745
F] COG0572 Uridine kinase. ali follow.. 14 5. AHQCVIIGIAGASASGKSLIASTLYRELREQVGDQHIGVIPEDG-----EERVKTNYDHPSAMDHNLLL------EHLQA ... F] COG0125 Thymidylate kinase. ali follow.. 32 2. ..SGLFITFEGPEGAGKTTVLQEIKNILTAE--GLQVMATREPGGIDIAEQIREVILNILMDPKTEALLYAAARRQH ... F] KOG3079 Uridylate kinase/adenylate kinase. ali follow.. 13 32. LMKPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDE--DSQYGELI ... F] COG0563 Adenylate kinase and related kinases. ali follow.. 13 3. ......LILMGLPGAGKGTQAEKIIEKYGIPHISTDMFRAAMKNETELGLKAKSYM ...
  http://ffas.burnham.org/ffas-cgi/cgi/get_mu.pl?ses=&rv=M.pneumoniae
*  ATCC 7953 Strain Passport - StrainInfo
Geobacillus stearothermophilus Bst UK gene for uridine kinase, complete cds, strain: ATCC 7953. ATCC 7953 ... Geobacillus stearothermophilus Bst ndk gene for nucleoside diphosphate kinase, complete cds, strain: ATCC 7953. ATCC 7953 ... Geobacillus stearothermophilus Bst UMPK gene for uridylate kinase, complete cds, strain: ATCC 7953. ATCC 7953 ... Geobacillus stearothermophilus Bst CMPK gene for cytidylate kinase, complete cds, strain: ATCC 7953. ATCC 7953 ...
  http://www.straininfo.net/strains/38704
*  IFO 15313 Strain Passport - StrainInfo
Bacillus caldolyticus Bcl UK gene for uridine kinase, complete cds, strain: NBRC 15313. NBRC 15313 ... Bacillus caldolyticus Bcl NDK gene for nucleoside diphosphate kinase, complete cds, strain: NBRC 15313. NBRC 15313 ... Bacillus caldolyticus Bcl UMPK gene for uridylate kinase, complete cds, strain: NBRC 15313. NBRC 15313 ... Bacillus caldolyticus Bcl CMPK gene for cytidylate kinase, complete cds, strain: NBRC 15313. NBRC 15313 ...
  http://www.straininfo.net/strains/46747
*  KEGG SSDB Best Search Result: cma:Cmaq 1916
19650 putative uridine kinase K00876 207 102 ( -) 29 0.302 169 ,-, 1 sus:Acid_5070 signal transduction histidine kinase with ... mic:Mic7113_2960 chemotaxis protein histidine kinase-li K02487.. 2161 101 ( -) 29 0.329 73 ,-, 1 ndi:NDAI_0C06170 hypothetical ... ddr:Deide_2p01130 putative histidine kinase, classic, b 764 102 ( -) 29 0.320 50 ,-, 1 ela:UCREL1_8890 putative efflux pump ... gba:J421_1163 tRNA uridine 5-carboxymethylaminomethyl m K03495 640 102 ( -) 29 0.317 104 -, 1 kphy:AOZ06_00545 LuxR family ...
  http://www.kegg.jp/ssdb-bin/ssdb_best?org_gene=cma:Cmaq_1916
*  KAKEN - Research Projects | Identification of factirs involved in formation of the Drosophila germ line (KAKENHI-PROJECT...
similar to uridine kinase. yeast SCOI protein. yeast CBF5/rat nucleolar protein NAP57. Drosophila three rows protein. Further ... Publications] Hayashi.S.他: 'Kinase-indenendent activity of Cdc/cyclin A revents' Genes to Cells. (in press).. *. Related Report ... Publications] Hayashi, S.and Yamaguchi, M.: 'Kinase-independent activity of Cdc2/Cyclin A prevents S phase in the Drosophila ...
  https://kaken.nii.ac.jp/grant/KAKENHI-PROJECT-09680712/
*  pyrH - Uridylate kinase - Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) - pyrH gene & protein
Uridylate kinase (EC:2.7.4.22). Short name: UK. Alternative name(s):. Uridine monophosphate kinase. Short name: ... IPR036393. AceGlu_kinase-like_sf. IPR001048. Asp/Glu/Uridylate_kinase. IPR011817. Uridylate_kinase. IPR011818. Uridylate_kinase ... IPR036393. AceGlu_kinase-like_sf. IPR001048. Asp/Glu/Uridylate_kinase. IPR011817. Uridylate_kinase. IPR011818. Uridylate_kinase ... Uridylate kinase (pyrH). This subpathway is part of the pathway CTP biosynthesis via de novo pathway, which is itself part of ...
  http://www.uniprot.org/uniprot/Q97ZE2
*  KEGG SSDB Best Search Result: pbl:PAAG 03986
obr:102721048 uridine kinase-like protein 3 K00876 489 111 ( 3) 31 0.302 126 -, 6 pfb:VO64_0375 putative cytochrome P450 ... shx:MS3_10538 A-kinase anchor protein 17A K13169 587 108 ( -) 30 0.329 70 -, 1 sind:105179817 asparagine synthetase domain- ... hmr:Hipma_0199 proposed homoserine kinase K15635 385 102 ( -) 29 0.306 121 -, 1 mac:MA_0697 oligopeptide ABC transporter, ATP- ... tig:THII_0843 receptor protein kinase-like protein 373 117 ( -) 33 0.308 104 -, 1 hoe:IMCC20628_02589 nitrile hydratase, beta ...
  http://www.kegg.jp/ssdb-bin/ssdb_best?org_gene=pbl:PAAG_03986
*  Novel and Stress-Regulated MicroRNAs and Other Small RNAs from Arabidopsis | Plant Cell
... protein kinase, casein kinase, and leucine-rich repeat-transmembrane [LRR-TM] kinase), and genes involved in RNA processing ( ... The presence of an additional U in miR319c makes it more similar to miR159 because both have three uridines at the 5′ end. This ... a casein kinase). Therefore, a slight change in miRNA sequence may alter its target preferences, distinguishing its role from ... our identification of small RNAs that might target putative LRR-TM kinase, 23s rRNA, AAO3, P5CDH, lipoxygenase, or LOB genes ...
  http://www.plantcell.org/content/16/8/2001.full
*  anti-UCP2 Primary Antibodies
anti-Unc-51-Like Kinase 3 (C. Elegans) Antikörper * anti-Unc-51 Like Kinase 2 (C. Elegans) Antikörper ...
  https://www.antikoerper-online.de/negative-regulation-of-hormone-secretion-pathway-43/ucp2-antibody-5459/