*  UDP-glucose 4-epimerase - Wikipedia
In the final Leloir step, UDP-glucose is regenerated from UDP-galactose by GALE; UDP-glucose cycles back to the third step of ... GeneReviews/NCBI/NIH/UW entry on Epimerase Deficiency Galactosemia OMIM entries on Epimerase Deficiency Galactosemia ... The enzyme UDP-glucose 4-epimerase (EC 5.1.3.2), also known as UDP-galactose 4-epimerase or GALE, is a homodimeric epimerase ... PDB: 1XEL​; Thoden JB, Frey PA, Holden HM (April 1996). "Molecular structure of the NADH/UDP-glucose abortive complex of UDP- ...
  https://en.wikipedia.org/wiki/UDP-glucose_4-epimerase
*  RCSB PDB - 1I3M: MOLECULAR BASIS FOR SEVERE EPIMERASE-DEFICIENCY GALACTOSEMIA: X-RAY STRUCTURE OF THE HUMAN V94M-SUBSTITUTED...
MOLECULAR BASIS FOR SEVERE EPIMERASE-DEFICIENCY GALACTOSEMIA: X-RAY STRUCTURE OF THE HUMAN V94M-SUBSTITUTED UDP-GALACTOSE 4- ... we have solved the structures of the V94M-substituted human epimerase complexed with NADH and UDP-glucose, UDP-galactose, UDP- ... One of the more severe cases of epimerase deficiency galactosemia arises from an amino acid substitution at position 94. It has ... MOLECULAR BASIS FOR SEVERE EPIMERASE-DEFICIENCY GALACTOSEMIA: X-RAY STRUCTURE OF THE HUMAN V94M-SUBSTITUTED UDP-GALACTOSE 4- ...
  https://www.rcsb.org/structure/1I3M
*  RCSB PDB for 1I3N
X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase. ... UDP-GLUCOSE 4-EPIMERASE A, B 348 Homo sapiens EC#: 5.1.3.2 IUBMB Mutation: V94M Gene Name(s): GALE Gene View ... MOLECULAR BASIS FOR SEVERE EPIMERASE-DEFICIENCY GALACTOSEMIA: X-RAY STRUCTURE OF THE HUMAN V94M-SUBSTITUTED UDP-GALACTOSE 4- ... C21 H27 N7 O14 P2 BAWFJGJZGIEFAR-NNYOXOHSSA-N ... Ligands 4 Unique. ID. Chains. Name / Formula / InChI Key. 2D ...
  http://www.rcsb.org/pdb/explore/biologyAndChemistry.do?structureId=1I3N
*  Extending the models for iron and sulfur oxidation in the extreme Acidophile Acidithiobacillus ferrooxidans | BMC Genomics |...
2005, 4: 63-70. 10.1021/pr049862f.View ArticlePubMedGoogle Scholar. *. Thony-Meyer L: Biogenesis of respiratory cytochromes in ... NH4)2SO4: 0.4 g. L-1, K2HPO4: 0.4 g. L-1, MgSO4-7H2O: 0.4 g. L-1 adjusted to pH 1.6 with H2SO4 or (ii) S0-medium (1% (w/v) ... A. ferrooxidans was grown at 30°C under oxic conditions with 200 rpm agitation in (i) Fe(II)-medium (62 mM FeSO4-7H2O in basal ... Mueller EG, Palenchar PM, Buck CJ: The role of the cysteine residues of ThiI in the generation of 4-thiouridine in tRNA. J Biol ...
  https://bmcgenomics.biomedcentral.com/articles/10.1186/1471-2164-10-394
*  Divergence of the SigB regulon and pathogenesis of the Bacillus cereus sensu lato group | BMC Genomics | Full Text
Cluster 4a also encodes UDP-glucose 4-epimerase, which catalyzes the conversion of UDP-glucose to UDP-galactose[81]. ... 2001, 9 (4): 157-View ArticlePubMedGoogle Scholar. *. van Schaik W, van der Voort M, Molenaar D, Moezelaar R, de Vos WM, Abee T ... 2007, 153 (Pt 4): 1187-1197.View ArticlePubMedGoogle Scholar. *. Kawai F, Shoda M, Harashima R, Sadaie Y, Hara H, Matsumoto K: ... 10.1007/s10482-008-9285-4.View ArticlePubMedGoogle Scholar. *. Helgason E, Okstad OA, Caugant DA, Johansen HA, Fouet A, Mock M ...
  https://bmcgenomics.biomedcentral.com/articles/10.1186/1471-2164-13-564
*  Analysis of 13000 unique Citrus clusters associated with fruit quality, production and salinity tolerance | BMC Genomics | Full...
10.1007/s10142-005-0143-4.PubMedView ArticleGoogle Scholar. *. Ma J, Morrow D, Fernandes J, Walbot V: Comparative profiling of ... 2002, 130 (4): 1788-1796. 10.1104/pp.008599.PubMed CentralPubMedView ArticleGoogle Scholar. ... 1987, 4 (4): 406-425.PubMedGoogle Scholar. *. Kumar S, Tamura K, Nei M: MEGA3: Integrated software for Molecular Evolutionary ... 10.1016/S0168-9452(03)00202-4.View ArticleGoogle Scholar. *. Close TJ, Wanamaker S, Lyon M, Mei G, Davies C, Roose ML: A ...
  https://bmcgenomics.biomedcentral.com/articles/10.1186/1471-2164-8-31
*  Galactosaminogalactan - Wikipedia
The UDP-glucose 4-epimerase Uge3 is responsible for these conversions. Bardalaye, P.C., and Nordin, J.H. (1976). ... These nucleotide sugars are not physiologically favored and must to be converted from UDP-glucose and Uridine diphosphate N- ... Overlapping and distinct roles of Aspergillus fumigatus UDP-glucose 4-epimerases in galactose metabolism and the synthesis of ... 4 glycosidic bonds. Galactosaminogalactan is typically extracted by ethanol precipitation from liquid culture or by alkaline ...
  https://en.wikipedia.org/wiki/Galactosaminogalactan
*  Table 1: List of all of the K
to UDP-glucose 4-epimerase Gal10p okam5c12d AJ229882 441 3.4 E-52 YPL110c simil. to C.elegans hypo. prt, weak simil. to Pho81p ... GAL10 UDP-glucose 4-epimerase okam5c11r# AJ229881 190 1.0 E-05 YNR071c strong simil. ... to Xenopus vimentin 4 okam3b05d AJ229630 360 okam3b05r AJ229631 468 okam3b06d AJ229632 384 6.3 E-68 YPL111w CAR1 arginase ... to dihydroflavonol-4-reductases okam5a09d AJ229845 232 4.4 E-36 YLR086w simil. to chromosome condensation prts okam5a09r ...
  http://mips.gsf.de/proj/yeast/reviews/klactis/rst_all_text.html
*  Moraxella catarrhalis (Frosch and Kolle) Bovre ATCC ® 25238™
Nucleotide (GenBank) : AF248584 Moraxella catarrhalis UDP-glucose dehydrogenase gene, partial cds; and UDP-glucose 4-epimerase ...
  https://www.atcc.org/en/Global/Products/8/D/5/4/25238.aspx
*  A compatible interaction of Alternaria brassicicola with Arabidopsis thalianaecotype DiG: evidence for a specific...
2006, 141 (4): 1248-1254. 10.1104/pp.106.082024.PubMedPubMed CentralView ArticleGoogle Scholar. ... 2003, 44 (4): 377-387. 10.1093/pcp/pcg050.PubMedView ArticleGoogle Scholar. ... Plant J. 2003, 33 (4): 733-742. 10.1046/j.1365-313X.2003.01665.x.PubMedView ArticleGoogle Scholar. ... For the SSH analysis the mRNA was enriched from the total RNA of Ast-0, Ast-3, Ast-4 and Ast-5 using the Qiagen Oligotex mRNA ...
  https://bmcplantbiol.biomedcentral.com/articles/10.1186/1471-2229-9-31
*  KEGG SSDB Best Search Result: byi:BYI23 B014300
mor:MOC_1401 NAD-dependent epimerase/dehydratase K01784 347 105 ( -) 30 0.308 117 -, 1 mphy:MCBMB27_00766 putative UDP-glucose ... ksk:KSE_46560 putative NAD-dependent epimerase/dehydrat K01784 327 106 ( 4) 30 0.318 107 -, 2 mao:MAP4_1389 1,4-alpha-glucan ( ... crg:105331706 4-coumarate--CoA ligase 1 555 101 ( -) 29 0.329 70 -, 1 ele:Elen_1362 Chloride channel core 393 101 ( -) 29 0.311 ... bmec:WJ16_09335 peptidase K06194 295 105 ( 4) 30 0.345 58 -, 2 ccro:CMC5_011580 thioredoxin 181 105 ( -) 30 0.310 113 -, 1 cell ...
  http://www.kegg.jp/ssdb-bin/ssdb_best?org_gene=byi:BYI23_B014300
*  Draft Genome Sequence of Streptomyces roseochromogenes subsp. oscitans DS 12.976, Producer of the Aminocoumarin Antibiotic...
UDP-glucose 4-epimerase (UNIPROT: V6K190). Organism: Streptomyces roseochromogenus subsp. oscitans DS 12.976. Download in FASTA ...
  https://pub.uni-bielefeld.de/publication/2647986
*  UDPglucose | definition of UDPglucose by Medical dictionary
UDPglucose explanation free. What is UDPglucose? Meaning of UDPglucose medical term. What does UDPglucose mean? ... Looking for online definition of UDPglucose in the Medical Dictionary? ... UDPglucose , definition of UDPglucose by Medical dictionary https://medical-dictionary.thefreedictionary.com/UDPglucose ... redirected from UDPglucose). Also found in: Encyclopedia. u·ri·dine di·phos·pho·glu·cose (UDPG, UDPGlc), (yūr'i-dēn dī-fos'fō- ...
  https://medical-dictionary.thefreedictionary.com/UDPglucose
*  Metabolism of halophilic archaea | SpringerLink
In accordance with this, several nucleotide sugar enzymes such as UDP-glucose 4-epimerase (EC 5.1.3.2, e.g. NP4662A) and UDP- ... methylmalonyl-CoA epimerase (EC 5.1.99.1, e.g. NP1228A) as well as methylmalonyl-CoA mutase (EC 5.4.99.2, e.g. NP1226A, NP2710A ... and ribulose-phosphate 3-epimerase (EC 5.1.3.1), is absent in most archaea except Methanococcus jannaschii and Thermoplasma spp ... 4, Supplementary Material S4). The latter is derived from GTP by a series of reactions involving folE, folB, and folK genes; ...
  https://link.springer.com/article/10.1007%2Fs00792-008-0138-x
*  TCDB » SEARCH
2] "Carbohydrate utilization in Streptococcus thermophilus: characterization of the genes for aldose 1-epimerase (mutarotase) ... and UDPglucose 4-epimerase." Poolman B.et.al. 1694527. External Searches:. *Search: nr SwissProt RefSeq DB with *BLAST ExPASy ( ...
  http://www.tcdb.org/search/result.php?tc=2.A.2.2.1
*  RCSB PDB - 1I3K: MOLECULAR BASIS FOR SEVERE EPIMERASE-DEFICIENCY GALACTOSEMIA: X-RAY STRUCTURE OF THE HUMAN V94M...
X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase. ... UDP-GLUCOSE 4-EPIMERASE (1I3K:A,B) * Udp N Acetylglucosamine 4 Epimerase Activity ... MOLECULAR BASIS FOR SEVERE EPIMERASE-DEFICIENCY GALACTOSEMIA: X-RAY STRUCTURE OF THE HUMAN V94M-SUBSTITUTED UDP-GALACTOSE 4- ... UDP-galactose 4-epimerase, domain 1 A2. 1i3kA02. Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like ...
  http://www.rcsb.org/pdb/explore/derivedData.do?structureId=1I3K
*  The RIO protein kinase-encoding gene Sj-riok-2 is involved in key reproductive processes in Schistosoma japonicum | Parasites &...
Schistosoma japonicum UDP-glucose 4-epimerase protein is located on the tegument and induces moderate protection against ... 2009;4:e6998.View ArticlePubMedPubMed CentralGoogle Scholar. *. Bobek LA, Rekosh DM, LoVerde PT. Schistosoma japonicum: ... 2006;4:199-210.View ArticlePubMedGoogle Scholar. *. Melman SD, Steinauer ML, Cunningham C, Kubatko LS, Mwangi IN, Wynn NB, et ... 4).. Fig. 5 Transcription localization of Sj-riok-2 detected by in situ hybridization on sections of adult worms of Schistosoma ...
  https://parasitesandvectors.biomedcentral.com/articles/10.1186/s13071-017-2524-7
*  Network Portal - Gene DVU0257
UDP-glucose 4-epimerase 37, 342. DVU1389. hypothetical protein DVU1389 69, 162. ... POSITION A C G T 1 1.0 0.0 0.0 0.0 2 0.0 0.0 0.0 1.0 3 0.0 0.25 0.0 0.75 4 0.0 0.0 1.0 0.0 5 0.0 1.0 0.0 0.0 6 0.0 0.0 0.0 1.0 ... POSITION A C G T 1 0.0 1.0 0.0 0.0 2 1.0 0.0 0.0 0.0 3 0.0 0.0 0.25 0.75 4 1.0 0.0 0.0 0.0 5 0.25 0.0 0.0 0.75 6 0.25 0.0 0.75 ... POSITION A C G T 1 1.0 0.0 0.0 0.0 2 0.0 0.0 0.0 1.0 3 0.0 0.0 1.0 0.0 4 1.0 0.0 0.0 0.0 5 0.0 1.0 0.0 0.0 6 0.625 0.0 0.375 ...
  http://networks.systemsbiology.net/dvu/gene/DVU0257
*  Network Portal - Gene VNG0014C
UDP-glucose 4-epimerase 254. VNG0826C. hypothetical protein VNG0826C 264. VNG1020C. hypothetical protein VNG1020C 264. ... POSITION A C G T 1 0.5 0.0 0.1 0.4 2 0.6 0.0 0.1 0.3 3 0.0 0.1 0.0 0.9 4 0.0 0.8 0.1 0.1 5 0.5 0.0 0.5 0.0 6 0.1 0.5 0.3 0.1 7 ... POSITION A C G T 1 0.0 0.0 0.0 1.0 2 0.0 1.0 0.0 0.0 3 0.0 1.0 0.0 0.0 4 1.0 0.0 0.0 0.0 5 0.0 0.0 1.0 0.0 6 1.0 0.0 0.0 0.0 7 ... POSITION A C G T 1 0.0 0.0 0.0 1.0 2 0.5 0.5 0.0 0.0 3 0.0 0.0 0.0 1.0 4 0.0 0.0 0.0 1.0 5 0.0 0.0 0.5 0.5 6 0.0 0.5 0.0 0.5 7 ...
  http://networks.systemsbiology.net/hal/gene/VNG0014C
*  Network Portal - Gene DVU0319
NAD-dependent epimerase/dehydratase CircVis. Functional Annotations (10). Function. System. UDP-glucose 4-epimerase. cog/ cog. ... UDP-glucose 4-epimerase activity. go/ molecular_function. carbohydrate metabolic process. go/ biological_process. dTDP-4- ... POSITION A C G T 1 1.0 0.0 0.0 0.0 2 0.0 0.0 0.0 1.0 3 0.0 1.0 0.0 0.0 4 1.0 0.0 0.0 0.0 5 0.0 0.0 0.0 1.0 6 1.0 0.0 0.0 0.0 7 ... POSITION A C G T 1 0.5 0.0 0.0 0.5 2 0.0 0.25 0.0 0.75 3 1.0 0.0 0.0 0.0 4 0.25 0.5 0.0 0.25 5 0.75 0.25 0.0 0.0 6 1.0 0.0 0.0 ...
  http://networks.systemsbiology.net/dvu/gene/DVU0319
*  UGE3 protein (Arabidopsis thaliana) - STRING network view
UDP-glucose/GDP-mannose dehydrogenase-like protein. UDP-GLUCOSE PYROPHOSPHORYLASE 1; Converts glucose 1-phosphate to UDP- ... UDP-glucose/GDP-mannose dehydrogenase-like protein. UDP-glucose dehydrogenase 4; Involved in the biosynthesis of UDP-glucuronic ... UDP-glucose/GDP-mannose dehydrogenase-like protein. UDP-glucose dehydrogenase 1; Involved in the biosynthesis of UDP-glucuronic ... UDP-glucose/GDP-mannose dehydrogenase-like protein. UDP-glucose dehydrogenase 2; Involved in the biosynthesis of UDP-glucuronic ...
  https://string-db.org/cgi/network.pl?identifier=3702.AT1G63180.1
*  Network Portal - Gene DVU0040
UDP-glucose 4-epimerase 37, 342. DVU1442. flagellin FlaG 37, 286. DVU1604. hypothetical protein DVU1604 37, 181. ... POSITION A C G T 1 1.0 0.0 0.0 0.0 2 0.0 0.0 0.0 1.0 3 0.0 0.25 0.0 0.75 4 0.0 0.0 1.0 0.0 5 0.0 1.0 0.0 0.0 6 0.0 0.0 0.0 1.0 ... POSITION A C G T 1 0.0 1.0 0.0 0.0 2 1.0 0.0 0.0 0.0 3 0.0 0.0 0.25 0.75 4 1.0 0.0 0.0 0.0 5 0.25 0.0 0.0 0.75 6 0.25 0.0 0.75 ... 4. Interactions between source and target genes for a particular module. * 5. Module(s) that source gene and target genes ...
  http://networks.systemsbiology.net/dvu/gene/DVU0040
*  Network Portal - Gene VNG0062G
UDP-glucose 4-epimerase 164, 280, 282. VNG0064G. graD3. glucose-1-phosphate thymidylyltransferase 74, 164, 280, 293. ... POSITION A C G T 1 0.0 0.0 0.0 1.0 2 1.0 0.0 0.0 0.0 3 1.0 0.0 0.0 0.0 4 0.0 0.0 0.0 1.0 5 0.0 0.0 1.0 0.0 6 0.0 0.0 1.0 0.0 7 ... POSITION A C G T 1 0.875 0.0 0.0 0.125 2 0.625 0.0 0.125 0.25 3 0.0 0.5 0.125 0.375 4 0.0 0.875 0.125 0.0 5 0.625 0.0 0.125 ... 4. Interactions between source and target genes for a particular module. * 5. Module(s) that source gene and target genes ...
  http://networks.systemsbiology.net/hal/gene/VNG0062G
*  Amar Nath Bhaduri - Wikipedia
Amar Nath Bhaduri (1935-2003) was an Indian molecular enzymologist and chemical biologist, known for his studies on UDP-glucose ... a homodimeric epimerase found in cells and his work on Leishmania donovani, the protozoal pathogen for Kala-azar. He was the ... UDP-glucose 4-epimerase Indian Institute of Chemical Biology India portal Biology portal "Handbook of Shanti Swarup Bhatnagar ... he elucidated the effect of uridine nucleotides on an epimerase. Later, he continued his researches at Jadavpur University and ...
  https://en.wikipedia.org/wiki/Amar_Nath_Bhaduri
*  RefSeq: NC 016797
"AGE family epimerase/isomerase" /protein_id="WP_002963690.1" /translation="MNDVIRKLQVEVERLSSWLHNDALPLWLSAGVDAPNSGFFERIG ... "UDP-glucose 4-epimerase" /protein_id="WP_004688196.1" /translation="MRVAVTGATGFVGSALVSKLEAAGHNVMPLSREDIHDADFSGVE ... "sugar phosphate isomerase/epimerase" /protein_id="WP_004688100.1" /translation="MKTIKGPGIFLGQFASDEAPFNTWDGITRWAAEKGYAGVQVPTW ... "ribulose-phosphate 3-epimerase" /protein_id="WP_004683663.1" /translation="MRPIAIAPSILSADFARLGEEVDAVLEAGADWVHIDVMDGHFVP ...
  http://www.genome.jp/dbget-bin/www_bget?refseq:NC_016797