Patatin-like phospholipase CapV in Escherichia coli - morphological and physiological effects of one amino acid substitution
We demonstrate here that overexpression of the patatin-like phospholipase variant CapV,sub,Q329R,/sub,, but not CapV, causes ... Publication types * Research Support, Non-U.S. Govt MeSH terms * Amino Acid Substitution ... Patatin-like phospholipase CapV in Escherichia coli - morphological and physiological effects of one amino acid substitution ... We demonstrate here that overexpression of the patatin-like phospholipase variant CapVQ329R, but not CapV, causes pronounced ...
Phospholipase PLA2G6, a Parkinsonism-Associated Gene, Affects Vps26 and Vps35, Retromer Function, and Ceramide Levels, Similar...
Publication types * Research Support, N.I.H., Extramural * Research Support, Non-U.S. Govt ... Phospholipase PLA2G6, a Parkinsonism-Associated Gene, Affects Vps26 and Vps35, Retromer Function, and Ceramide Levels, Similar ... Phospholipases typically hydrolyze glycerol phospholipids, but loss of iPLA2-VIA does not affect the phospholipid composition ...
Plus it
Bovine Secretory PLA2 Type IB.. Bovine secretory PLA2 (sPLA2) type IB was a commercially available product (Sigma-Aldrich). PLA ... independent phospholipase A2β. LOX. lipoxygenase. LPS. lipopolysaccharide. LT. leukotriene. LTB4. leukotriene B4. LTE4. ... phospholipase A2. RA. rheumatoid arthritis. RBL-2H3. rat basophilic leukemia 2H3. SD. Sprague-Dawley. sPLA2. secretory ... cytosolic phospholipase A2. CV. cardiovascular. GI. gastrointestinal. IPF. idiopathic pulmonary fibrosis. iPLA2β. ...
PLCD4 phospholipase C delta 4 [Homo sapiens (human)] - Gene - NCBI
Gene type. protein coding. RefSeq status. REVIEWED. Organism. Homo sapiens Lineage. Eukaryota; Metazoa; Chordata; Craniata; ... PLN02222; phosphoinositide phospholipase C 2. cd13363. Location:18 → 133. PH_PLC_delta; Phospholipase C-delta (PLC-delta) ... PLN02222; phosphoinositide phospholipase C 2. cd13363. Location:18 → 133. PH_PLC_delta; Phospholipase C-delta (PLC-delta) ... This gene encodes a member of the delta class of phospholipase C enzymes. Phospholipase C enzymes play a critical role in many ...
RCSB PDB - 4HYQ: Crystal structure of phospholipase A1 from Streptomyces albidoflavus NA297
Crystal structure of phospholipase A1 from Streptomyces albidoflavus NA297 ... phospholipase A1. A. 236. Streptomyces albidoflavus. Mutation(s): 0 Gene Names: PLA1, C0Q92_26465, Salbus254_5377, XNRR2_5106. ... Crystal structure of phospholipase A1 from Streptomyces albidoflavus NA297. Murayama, K., Kano, K., Matsumoto, Y., Sugimori, D. ... The metal-independent lipase from Streptomyces albidoflavus NA297 (SaPLA1) is a phospholipase A1 as it preferentially ...
Molecular interactions of phospholipid monolayers with a model phospholipase - Soft Matter (RSC Publishing)
The intrinsic overexpression of secretory phospholipase A2 (sPLA2) in various pro-inflammatory diseases and cancers has the ... Article type. Paper. Submitted. 06 Jun 2018. Accepted. 01 Apr 2019. First published. 02 Apr 2019. ... Molecular interactions of phospholipid monolayers with a model phospholipase P. Zhang, V. Villanueva, J. Kalkowski, C. Liu, A. ... The intrinsic overexpression of secretory phospholipase A2 (sPLA2) in various pro-inflammatory diseases and cancers has the ...
Phospholipase C - Wikipedia
The bacterial variant Clostridium perfringens type A produces alpha-toxin. The toxin has phospholipase C activity, and causes ... PLCZ1 phospholipase C-like: PLCL1, PLCL2 Most of the bacterial variants of phospholipase C are characterized into one of four ... Zinc-dependent phospholipase C family of bacterial enzymes EC 3.1.4.3 that includes the alpha toxins of C. perfringens (also ... Phospholipase C (PLC) is a class of membrane-associated enzymes that cleave phospholipids just before the phosphate group (see ...
Activation of phospholipase A2 by temporin B: Formation of antimicrobial peptide-enzyme amyloid-type cofibrils
Human Metabolome Database: Showing Protein Group XIIB secretory phospholipase A2-like protein (HMDBP00062)
Protein Type. Unknown. Biological Properties. General Function. Involved in phospholipase A2 activity. ... Showing Protein Group XIIB secretory phospholipase A2-like protein (HMDBP00062). IdentificationBiological propertiesGene ... Rouault M, Bollinger JG, Lazdunski M, Gelb MH, Lambeau G: Novel mammalian group XII secreted phospholipase A2 lacking enzymatic ... Group XIIB secretory phospholipase A2-like protein MKLASGFLVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGK ...
Studies of the interfacial and heparin binding properties of secreted phospholipases A2 - ePrints Soton
Preliminary analysis of this mutant enzyme has revealed that it still has about 40% of the activity of the wild-type, however, ... Preliminary analysis of this mutant enzyme has revealed that it still has about 40% of the activity of the wild-type, however, ... Baker, Sharon Felicity (1998) Studies of the interfacial and heparin binding properties of secreted phospholipases A2. ... The human mutant had 40% of the activity of the wild-type enzyme when assayed using anionic phospholipids, however, a dramatic ...
Phospholipase C beta Summary Report | CureHunter
It is structurally related to PHOSPHOLIPASE C DELTA with the addition of C-terminal extension of 400 residues. ... A phosphoinositide phospholipase C subtype that is primarily regulated by its association with HETEROTRIMERIC G-PROTEINS. ... Phospholipases: 1677*Type C Phospholipases: 869*Phosphoinositide Phospholipase C: 92*Phospholipase C beta: 86*C elegans Egl-8 ... Phospholipase C beta2; Phospholipase C beta3; Phospholipase C beta4; Phospholipase C-beta; Phospholipase C-beta1; Phospholipase ...
Alpha-type phospholipase A2 inhibitor family | canSARS
Go to Cyclin A2 modulates EMT via beta-catenin and phospholipase C pathways.
Type C Phospholipases/genetics/*metabolism; Wnt Signaling Pathway/drug effects ... Cyclin A2 modulates EMT via beta-catenin and phospholipase C pathways. Cheung, C. T.; Bendris, N.; Paul, C.; Hamieh, A.; Anouar ... This suggests that a WNT-independent mechanism of beta-catenin activation via phospholipase C is involved in the EMT induced by ... porcupine inhibitor C59 did not reverse EMT whereas a dominant negative form of TCF4 as well as inhibition of phospholipase C ...
Domain-induced activation of human phospholipase A2 type IIA - Staff of the Department of Food Science
Secretory human phospholipase A2 type IIA (PLA2-IIA) catalyzes the hydrolysis of the sn-2 ester bond in glycerolipids to ... Domain-induced activation of human phospholipase A2 type IIA: Local versus global lipid composition. Research output: ...
Chromosome 9 - Wikipedia
PIP5K1B: phosphatidylinositol-4-phosphate 5-kinase type-1 beta. *PLAA: phospholipase A-2-activating protein ... IFN1@: Interferon, type 1, cluster. *IKBKAP: inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex- ... This type of ideogram is generally used in genome browsers (e.g. Ensembl, UCSC Genome Browser). ... The ABO gene, which determines ABO blood type, is located on the long arm of this chromosome. (Location: 9q34.2). .mw-parser- ...
Secreted phospholipase A2 type IIA as a mediator connecting innate and adaptive immunity: new role in atherosclerosis
... markers of macrophage/dendritic cells as well as high levels of inflammatory proteins such as secreted phospholipase A2 type ...
Lithium activates brain phospholipase A2 and improves memory in rats: implications for Alzheimer's disease | SpringerLink
Phospholipase A2 (Pla2) is required for memory retrieval, and its inhibition in the hippocampus has been reported to impair ... Lithium therapy improves neurological function and hippocampal dendritic arborization in a spinocerebellar ataxia type 1 mouse ... Lithium activates brain phospholipase A2 and improves memory in rats: implications for Alzheimers disease. *Fábio B. Mury1,2, ... Mury, F.B., da Silva, W.C., Barbosa, N.R. et al. Lithium activates brain phospholipase A2 and improves memory in rats: ...
Advances in the Pathogenesis of Auto-antibody-Induced Cerebellar Synaptopathies | The Cerebellum
P/Q-type) [62]. On the other hand, PF inputs in dendritic spines activate the mGluR-phospholipase C β(PLCβ)-inositol ... The action potential at the presynaptic terminal activates the VGCCs, such as P/Q-type and/or N-type Ca2+-channel. Anti-VGCC ... P/Q type Ca2+ voltage-gated channel; PLC, phospholipase C; PKC, protein kinase C; IP3, inositol triphosphate; GRIP, glutamate ... Levels of serum anti-GAD65 Ab titers are usually more than 2000 U/mL, or 10- to 100-fold those in patients with type 1 diabetes ...
Autotaxin-Lysophosphatidic Acid: From Inflammation to Cancer Development
Phospholipase D. sPLA2:. Secreted phospholipase A2. LPP1:. Lipid phosphate phosphohydrolase type 1. ... H. Kawagoe, O. Soma, J. Goji et al., "Molecular cloning and chromosomal assignment of the human brain-type phosphodiesterase I/ ... A second, less common, route of LPA production is the cleavage of phospholipids into phosphatidic acid (PA) by phospholipase D ... J. L. Tomsig, A. H. Snyder, E. V. Berdyshev et al., "Lipid phosphate phosphohydrolase type 1 (LPP1) degrades extracellular ...
Phenotypes of pain behavior in phospholipase C-related but catalytically inactive protein type 1 knockout mice | Molecular Pain...
β2 subunit mRNA expression was significantly higher in PRIP-1 -/- mice than in wild-type mice in all areas of the spinal cord. ... In this study, we investigated the phenotypes of pain behaviors in PRIP type 1 knockout (PRIP-1 -/- ) mice. The mutant mice ... hyperalgesic responses in the second phase of the formalin test and the von Frey test as compared with those in wild-type mice ... Phospholipase C-related inactive protein (PRIP) plays important roles in trafficking to the plasma membrane of GABAA receptor, ...
Regulation of phospholipases C and D in rat ventricular myocytes: stimulation by endothelin-1, bradykinin and phenylephrine. -...
Item Type:. Article. Refereed:. Yes. Divisions:. Life Sciences , School of Biological Sciences , Biomedical Sciences. ... by phospholipase C (PLC) or phosphatidylcholine by phospholipase D (PLD). We have measured activation of these phospholipases ... Clerk, A. and Sugden, P. H. (1997) Regulation of phospholipases C and D in rat ventricular myocytes: stimulation by endothelin- ... Regulation of phospholipases C and D in rat ventricular myocytes: stimulation by endothelin-1, bradykinin and phenylephrine. ...
Hanh Lam | Department of Biological Sciences | Virginia Tech
Develop inhibitors of the Type III secretion system. *Develop inhibitors of bacterial phospholipases ... The Type III secretion system (T3SS) is a major virulence determinant associated with acute Pseudomonas infection. The T3SS is ... ExoU has phospholipase A2 activity, which can hydrolyze phospholipids such as phosphatidylinositol 4,5-bisphosphate (PIP2). ...
MMRRC:040105-MU
Name: phospholipase A1 member A. Synonyms: Ps-pla1. Type: Gene. Species: Mus musculus (mouse) ... When maintaining a live colony, heterozygous mice may be bred together, bred with wild-type siblings, or bred with C57BL/6J ... Name: Tax1 (human T cell leukemia virus type I) binding protein 3 ... Name: membrane associated ring-CH-type finger 2. Synonyms: ...
Frontiers | Inhibition of synaptic transmission by anandamide precursor 20:4-NAPE is mediated by TRPV1 receptors under...
4-NAPE-induced inhibition was blocked by anandamide-synthesizing enzyme N-acyl phosphatidylethanolamine phospholipase D (NAPE- ... 4-NAPE-induced inhibition was blocked by anandamide-synthesizing enzyme N-acyl phosphatidylethanolamine phospholipase D (NAPE- ... type 1 (TRPV1) cation channel, and cannabinoid receptor 1 (CB1) are essential in the modulation of nociceptive signaling in the ... type 1 (TRPV1) cation channel, and cannabinoid receptor 1 (CB1) are essential in the modulation of nociceptive signaling in the ...
KEGG PATHWAY: hsa05152
PLA2R1; phospholipase A2 receptor 1 [KO:K06560]. 4360 MRC1; mannose receptor C-type 1 [KO:K06560]. ... CLEC7A; C-type lectin domain containing 7A [KO:K10074]. 6714 SRC; SRC proto-oncogene, non-receptor tyrosine kinase [KO:K05704 ... The role of Syk/CARD9-coupled C-type lectin receptors in immunity to Mycobacterium tuberculosis infections. ... PIK3C3; phosphatidylinositol 3-kinase catalytic subunit type 3 [KO:K00914] [EC:2.7.1.137]. ...
Oxygen sensing and signal transduction in hypoxic pulmonary vasoconstriction | European Respiratory Society
... which may enhance the importance of L-type calcium channels [49]. Moreover, the role of L-type calcium channels may differ in ... phosphatidylinositol-specific phospholipase C; PC-PLC: phosphatidylcholine-specific phospholipase C; p47phox: 47-kDa cytosolic ... transient receptor potential canonical channel type 6; TRPV4: transient receptor potential vanilloid channel type 4; VDCC: ... transient receptor potential canonical channel type 6; TRPV4: transient receptor potential vanilloid channel type 4; VDCC: ...