Thermoplasma Search Species2000 page for Thermoplasma MicrobeWiki page for Thermoplasma LPSN page for Thermoplasma Thermoplasma ... PubMed references for Thermoplasma PubMed Central references for Thermoplasma Google Scholar references for Thermoplasma NCBI ... In taxonomy, Thermoplasma is a genus of the Thermoplasmataceae. Thermoplasma is a genus of archaea. It belongs to the ... Thermoplasma are facultative anaerobes and respire using sulfur and organic carbon. They do not contain a cell wall but instead ...
Taxonomy information for Thermoplasma volcanium GSS1. Find diseases associated with this biological target and compounds tested ...
Classification and research data for Thermoplasma acidophilum, a species of archaea in the family Thermoplasmataceae.. ...
Crystal structure of a nicotinate phosphoribosyltransferase from Thermoplasma acidophilum with nicotinate mononucleotide ...
Crystal structures of the tricorn interacting factor F3 from Thermoplasma acidophilum, a zinc aminopeptidase in three different ... Crystal structures of the tricorn interacting factor F3 from Thermoplasma acidophilum, a zinc aminopeptidase in three different ... Crystal structures of the tricorn interacting factor F3 from Thermoplasma acidophilum, a zinc aminopeptidase in three different ...
Species: Thermoplasma acidophilum [TaxId:2303]. Database cross-references and differences (RAF-indexed): *Uniprot P48424 ... Species: Thermoplasma acidophilum [TaxId:2303]. Database cross-references and differences (RAF-indexed): *Uniprot P48425 ... Keywords: thermoplasma acidophilum, group II chaperonin, cct, tric, protein folding, ATPase, chaperonin. Deposited on 1998-02- ...
Pathare, G. R.; Nagy, I.; Hubert, A.; Thomas, D. R.; Bracher, A.: Crystal structure of the Thermoplasma acidophilum protein ... Hubert, A.; Mitani, Y.; Tamura, T.; Boicu, M.; Nagy, I.: Protein complex purification from Thermoplasma acidophilum using a ... Hubert, A.: Needle in a haystack: Protein complex purification from Thermoplasma acidophilum with a phage display library. ...
A 20-S protein composed of 28 subunits arranged in four rings of seven. -!- The outer rings are composed of alpha subunits, but the beta subunits forming the inner rings are responsible for peptidase activity. -!- In eukaryotic organisms there are up to seven different types of beta subunits, three of which may carry the N-terminal threonine residues that are the nucleophiles in catalysis, and show different specificities. -!- The molecule is barrel-shaped, and the active sites are on the inner surfaces. -!- Terminal apertures restrict access of substrates to the active sites. -!- Inhibited by mercurial reagents and some inhibitors of serine endopeptidases. -!- Belongs to peptidase family T1. -!- Formerly EC 3.4.22.21, EC 3.4.24.5 and EC 3.4.99.46 ...
Hocher A, Rojec M, Swadling JB, Esin A, Warnecke T. The DNA-binding protein HTa from Thermoplasma acidophilum is an archaeal ... Thermoplasma acidophilum histone-like protein. Partial amino acid sequence suggestive of homology to eukaryotic histones. ... Nucleoprotein subunit structure in an unusual prokaryotic organism: Thermoplasma acidophilum. Biochim Biophys Acta. 1980;609(1 ... Thermoplasma acidophilum [31], and Methanocaldococcus jannaschii [32]. Furthermore, very little is known about the relationship ...
Thermoplasma / genetics Actions. * Search in PubMed * Search in MeSH * Add to Search ...
Most prokaryotes have a cell wall (some exceptions are Mycoplasma, a bacterium, and Thermoplasma, an archaeon. It consists of ...
The enzyme from the archaea Thermoplasma acidophilum and Picrophilus torridus is involved in the non-phosphorylative Entner- ... Identification and characterization of Thermoplasma acidophilum glyceraldehyde dehydrogenase: a new class of NADP+-specific ... Glyceraldehyde dehydrogenases from the thermoacidophilic euryarchaeota Picrophilus torridus and Thermoplasma acidophilum, key ...
Structural insights into unique substrate selectivity of Thermoplasma acidophilum D-aldohexose dehydrogenase.. Yasutake Y; ...
compare their sequence of Thermoplasma volcanium with existing genomic sequences of seven other archaeons, and find that ... Thermoplasma volcanium. with existing genomic sequences of seven other archaeons, and find that thermophiles adapt to ... compare their sequence of Thermoplasma volcanium with existing genomic sequences of seven other archaeons, and find that ...
A third mevalonate pathway variant found in Thermoplasma acidophilum, phosphorylates mevalonate at the 3-OH position followed ... mevalonate-3-phosphate is an intermediate of the mevalonate pathway in Thermoplasma acidophilum. J Biol Chem 289:15957-15967. ...
Thermoplasma B02.500 Korarchaeota B02.600 Nanoarchaeota B03 Bacteria B03.026 Acidobacteria B03.054 Agricultural Inoculants ...
Crystal Structure of a Conserved CBS Domain Protein TA0289 of Unknown Function from Thermoplasma acidophilum. ...
X-ray snapshots of peptide processing in mutants of tricorn-interacting factor F1 from Thermoplasma acidophilum. J Biol Chem ... Navigation inside a protease: Substrate selection and product exit in the tricorn protease from Thermoplasma acidophilum. J Mol ... Crystal structures of the tricorn interacting factor F3 from Thermoplasma acidophilum, a zinc aminopeptidase in three different ...
... and the Thermoplasma acidophilum XPD (taXPD) as a template (Protein Data Bank entries 2vsf and 4a15 [27, 28]; HH-PRED E-value ...
The best quality, top Sheep Anti Rabbit Creatine Phosphokinase products prices, quick delivery. ...
Thermoplasma Preferred Term Term UI T040593. Date01/01/1999. LexicalTag NON. ThesaurusID NLM (1976). ... Thermoplasma Preferred Concept UI. M0021308. Registry Number. txid2302. Scope Note. A genus of facultatively anaerobic ... Thermoplasma. Tree Number(s). B02.200.850.800. Unique ID. D013822. RDF Unique Identifier. http://id.nlm.nih.gov/mesh/D013822 ...
Thermoplasma Preferred Term Term UI T040593. Date01/01/1999. LexicalTag NON. ThesaurusID NLM (1976). ... Thermoplasma Preferred Concept UI. M0021308. Registry Number. txid2302. Scope Note. A genus of facultatively anaerobic ... Thermoplasma. Tree Number(s). B02.200.850.800. Unique ID. D013822. RDF Unique Identifier. http://id.nlm.nih.gov/mesh/D013822 ...
Keum Young Ahn, Ho Kyung Ko, Bo Ram Lee, Eun Jung Lee, Jong Hwan Lee, Youngro Byun, Ick Chan Kwon, Kwangmeyung Kim, Jeewon ...
Archaea is a domain of single-celled organisms. These microorganisms lack cell nuclei and are therefore prokaryotes. Uncommon bacteria such as those found in environments that are devoid of oxygen or are extremely acidic ...
Genus Thermoplasma (organism) {439693004 , SNOMED-CT } Parent/Child (Relationship Type) Thermoplasma acidophilum (organism) { ...
Thermoplasma acidophilum missing residues P: 161-172 ec nomenclature. ec 3.4.25.1: Proteasome endopeptidase complex. ec 3.4. ...
Genus Thermoplasma. *Group [Extremely Halophilic Archaeobacteria] [III] *Order Halobacteriales *Family Halobacteriaceae *Genus ...
Transcriptional factor fur from Thermoplasma volcanium binds its own promoter DNA in a divalent cation-dependent manner. Ikeda ... Specificity of Fur binding to the oxidative stress response gene promoter in the facultative anaerobic archaeon Thermoplasma ...
Kebanyakan arkea (kecuali Thermoplasma dan Ferroplasma) memiliki dinding sel.[100] Mayoritas dinding sel arkea dirakit dari ... Hixon WG, Searcy DG; Searcy (1993). "Cytoskeleton in the archaebacterium Thermoplasma acidophilum? Viscosity increase in ... Dalam Thermoplasma dan Ferroplasma, ketiadaan dinding sel berarti bahwa sel memiliki bentuk yang tidak teratur, dan dapat ... "An actin homolog of the archaeon Thermoplasma acidophilum that retains the ancient characteristics of eukaryotic actin". J. ...
Thermoplasma acidophilum. GB. GSA_THEAC. SQ. MQWQAMGSKDLFQRGSSLFPMGVNSPVRYFKDYPFYVDNASGSRIYDVDGNEYIDYCLAY ...