Riboflavin synthase - Wikipedia
Archeal riboflavin synthase forms as a homopentamer, whereas eubacterial, fungal and plant riboflavin synthase exists as a ... Riboflavin synthase is an enzyme that catalyzes the final reaction of riboflavin biosynthesis. It catalyzes the transfer of a ... As Gram-negative bacteria need to produce their own riboflavin, inhibiting riboflavin synthase or other enzymes involved in the ... Scientists have hypothesized that enzymes involved in the riboflavin biosynthesis pathway, including riboflavin synthase, can ...
Figure 2 - Isolation of Bartonella sp. from Sheep Blood - Volume 13, Number 10-October 2007 - Emerging Infectious Diseases...
MiFuP - 微生物
MiFuP - 微生物
Ulrich Hartl Selected Publications | Max Planck Institute of Biochemistry
Biosynthesis of riboflavin in archaea studies on the mechanism of 3,4-dihydroxy-2-butanone-4-phosphate synthase of ... Riboflavin synthase of Schizosaccharomyces pombe. Protein dynamics revealed by 19F NMR protein perturbation experiments. BMC ... Studies on the reaction mechanism of riboflavin synthase: X-ray crystal structure of a complex with 6-carboxyethyl-7-oxo-8- ... Crystal structure of Schizosaccharomyces pombe riboflavin kinase reveals a novel ATP and riboflavin-binding fold. Journal of ...
SCOP 1.57: Domain d1i8dc1: 1i8d C:1-90
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) *. Family b.43.4.3: Riboflavin synthase [63783] (1 ... PDB Description: crystal structure of riboflavin synthase. SCOP Domain Sequences for d1i8dc1:. Sequence; same for both SEQRES ... d1i8dc1 b.43.4.3 (C:1-90) Riboflavin synthase {Escherichia coli} mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs ...
EC 2.5.1.* (non-methyl-alkyl or aryl transferase) inhibitor - Ontology Report - Rat Genome Database
SCOPe 2.07: Domain d1w35a1: 1w35 A:9-141
Recent advancements in the light-struck taste in white wine
Cloning, characterization, and expression of the RIB5 gene encoding riboflavin synthase. The Journal of Biological Chemistry ... Riboflavin occurs in law amount in grape (few tens μg/L of grape juice) (Riberau-Gayon et al., 2006) and it increases during ... Figure 6: 1H-NMR spectra (600 MHz) for 2 mM methionine and 0.2 mM riboflavin in H2O/D2O 9:1 (v/v) exposed to light in air ... Oenological strategy (iii): removal of riboflavin. The three actors of the appearance of LST in white wine are RF, Met and, ...
BiGG Reaction RBFSb in iS 1188
PathBank
riboflavin. synthase. Adenine. phosphoribosyltransferase. AMP. nucleosidase. Adenosine. Adenosine. H. +. H. +. Adenosine. H. + ... The structure of the N-terminal domain of riboflavin synthase in complex with riboflavin at 2.6A resolution. J Mol Biol. 2003 ... mapping and hyperexpression of the ribC gene coding for riboflavin synthase of Escherichia coli. Eur J Biochem. 1996 Dec 15;242 ...
CRP34584 details
riboflavin synthase complex. IEP. Enrichment. BP. GO:0009987. cellular process. IEP. Enrichment. ... proton-transporting ATP synthase complex, catalytic core F(1). IEP. Enrichment. BP. GO:0046034. ATP metabolic process. IEP. ... proton-transporting ATP synthase activity, rotational mechanism. IEP. Enrichment. BP. GO:0055086. nucleobase-containing small ...
Dusal.0209s00002.1 details
Protein Ontology
Protein Ontology
Zm00001e032495 P001 details
riboflavin synthase complex. IEP. Neighborhood. MF. GO:0009678. hydrogen-translocating pyrophosphatase activity. IEP. ... fatty acid synthase activity. IEP. Neighborhood. MF. GO:0004315. 3-oxoacyl-[acyl-carrier-protein] synthase activity. IEP. ... proton-transporting ATP synthase complex, coupling factor F(o). IEP. Neighborhood. BP. GO:0045454. cell redox homeostasis. IEP ... proton-transporting ATP synthase complex, catalytic core F(1). IEP. Neighborhood. CC. GO:0045263. ...
Cluster 23 details
riboflavin synthase complex. 2.17% (1/46). 6.49. 0.011111. 0.039247. GO:0008531. riboflavin kinase activity. 2.17% (1/46). 6.49 ... riboflavin metabolic process. 4.35% (2/46). 5.49. 0.000715. 0.006521. GO:0009231. riboflavin biosynthetic process. 4.35% (2/46) ... lipid-A-disaccharide synthase activity. 2.17% (1/46). 6.49. 0.011111. 0.039247. GO:0019682. glyceraldehyde-3-phosphate ...
ribA protein (Burkholderia cepacia) - STRING interaction network
Riboflavin synthase subunit alpha; Derived by automated computational analysis using gene prediction method: Protein Homology. ... Cyclic pyranopterin phosphate synthase MoaA; Catalyzes the cyclization of GTP to (8S)-3,8-cyclo-7,8- dihydroguanosine 5- ... Cyclic pyranopterin phosphate synthase MoaA; Catalyzes the cyclization of GTP to (8S)-3,8-cyclo-7,8- dihydroguanosine 5- ... Cyclic pyranopterin phosphate synthase MoaA; Catalyzes the cyclization of GTP to (8S)-3,8-cyclo-7,8- dihydroguanosine 5- ...
Hb 055619 010
PREDICTED: riboflavin synthase [Jatropha curcas]. 12. Hb_035273_020. 0.1130186137. -. -. PREDICTED: amidase 1-like isoform X1 [ ... PREDICTED: FAD synthase isoform X3 [Jatropha curcas]. 8. Hb_005127_030. 0.1019749496. -. -. PREDICTED: tryptophan--tRNA ligase ... cysteine synthase, putative [Ricinus communis]. 3. Hb_005731_160. 0.0806420038. -. -. ABC transporter family protein [Hevea ...
AT3G06170
Riboflavin synthase-like superfamily protein. -0.74. 0.3. -0.32. 58. AT3G62870. Ribosomal protein L7Ae/L30e/S12e/Gadd45 family ... INOSITOL 3-PHOSPHATE SYNTHASE 2,. MYO-INOSITOL-1-PHOSTPATE SYNTHASE. 2, myo-inositol-1-phosphate. synthase 2. 0.74. 0.34. -0.33 ... Riboflavin synthase-like superfamily protein. 0.7. 0.31. -0.29. 141. AT3G52460. hydroxyproline-rich glycoprotein family protein ... Pseudouridine synthase family protein. -0.71. 0.35. -0.29. 113. AT3G10210. SEC14 cytosolic factor family protein / ...
FMN: Pseudomonadaceae
Funciton: Riboflavin synthase alpha chain (EC 2.5.1.9) Locus tag: Pmen_3855. Name: ribBA. Funciton: 3,4-dihydroxy-2-butanone 4- ... Funciton: 3,4-dihydroxy-2-butanone 4-phosphate synthase / GTP cyclohydrolase II (EC 3.5.4.25) ... Funciton: 3,4-dihydroxy-2-butanone 4-phosphate synthase / GTP cyclohydrolase II (EC 3.5.4.25) ... Funciton: 3,4-dihydroxy-2-butanone 4-phosphate synthase / GTP cyclohydrolase II (EC 3.5.4.25) ...
Riboflavin Deficiency: Overview, Riboflavin Requirements, Clinical Features of Deficiency (Ariboflavinosis)
Riboflavin, or vitamin B-2, was initially isolated from milk whey in 1879. Originally called lactochrome, it was also once ... Riboflavin-responsive and -non-responsive mutations in FAD synthase cause multiple acyl-CoA dehydrogenase and combined ... Riboflavin is absorbed in the small intestine by the human riboflavin transporters RFVT1 and RFVT3. A third riboflavin ... Riboflavin Replenishment. Treatment of riboflavin deficiency consists of riboflavin replenishment, with care taken not to ...
FMN: Thermotogales
Funciton: Riboflavin synthase alpha chain (EC 2.5.1.9) Locus tag: Tnap_1001. Name: ribBA. Funciton: 3,4-dihydroxy-2-butanone 4- ... Funciton: 3,4-dihydroxy-2-butanone 4-phosphate synthase / GTP cyclohydrolase II (EC 3.5.4.25) ... Funciton: 3,4-dihydroxy-2-butanone 4-phosphate synthase / GTP cyclohydrolase II (EC 3.5.4.25) ... Funciton: 3,4-dihydroxy-2-butanone 4-phosphate synthase / GTP cyclohydrolase II (EC 3.5.4.25) ...
FFAS03 list of results C.acetobutylicum / HGM OVER
Riboflavin as a promising antimicrobial agent? A multi-perspective review
... highlighting the possible role of riboflavin as an antimicrobial agent. Moreover, riboflavin and flavins could produce reactive ... Riboflavin could also be involved in modulating host immune responses, which might increase the pathogen clearance from host ... Riboflavin consisting of two important cofactors, flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD), which are ... Hence, this review aimed to provide some insights on the promising role of riboflavin as an antimicrobial candidate and also a ...
Pesquisa | Portal Regional da BVS
Riboflavin synthase is present in all the enriched strains but not in depleted species. The critical role of riboflavin ... A novel model of the CRC pathogenesis involving riboflavin synthase and other related proteins including TpiA and GrxC was ... Furthermore, we predicted 76 potential virulence factors without homology to human proteins, including two riboflavin synthase ... study predicted many new pathogenetic factors and developed a new model of CRC pathogenesis involving the riboflavin synthase ...
Evasion of MAIT cell recognition by the African Salmonella Typhimurium ST313 pathovar that causes invasive disease - LSTM...
Supramolecular assembly of protein building blocks: from folding to function | Nano Convergence | Full Text
R. Ladenstein, M. Fischer, A. Bacher, The lumazine synthase/riboflavin synthase complex: shapes and functions of a highly ... J. Min et al., Lumazine synthase protein cage nanoparticles as modular delivery platforms for targeted drug delivery. RSC Adv. ... Naturally derived self-assembly proteins such as ferritin and lumazine synthase have been used for cell signaling [186] and ... E. Morgunova et al., Crystal structure of lumazine synthase from Mycobacterium tuberculosis as a target for rational drug ...
Efficient production of bacterial antibiotics aminoriboflavin and roseoflavin in eukaryotic microorganisms, yeasts | Microbial...
Roseoflavin biosynthesis genes have been expressed in riboflavin- or FMN-overproducing yeast strains of Candida famata and ... 8-demethyl-8-amino-riboflavin-5′-phosphate synthase (EC 2.6.1.114), AF-phosphate phosphatase and dimethyltransferase (EC 2.1. ... Strain Y-33/FMN1-rosB accumulated 17 mg L-1 AF and 569 mg L-1 riboflavin after 96 h of fed-batch cultivation. AF and riboflavin ... As the solubility of riboflavin is ~ 200 mg L-1, a 1 mL aliquot of culture broth was diluted to adjust the riboflavin content ...