Phospholipase - Wikipedia
Phospholipase A Phospholipase A1 - cleaves the sn-1 acyl chain (where sn refers to stereospecific numbering). Phospholipase A2 ... Phospholipase B - cleaves both sn-1 and sn-2 acyl chains; this enzyme is also known as a lysophospholipase. Phospholipase C - ... Phospholipase A2 is an enzyme present in the venom of bees, blennies and viper snakes. Patatin-like phospholipase Infantile ... Endothelial lipase is primarily a phospholipase. Phospholipase A2 acts on the intact lecithin molecule and hydrolyzes the fatty ...
PLCD4 phospholipase C delta 4 [Homo sapiens (human)] - Gene - NCBI
PLN02222; phosphoinositide phospholipase C 2. cd13363. Location:18 → 133. PH_PLC_delta; Phospholipase C-delta (PLC-delta) ... PLN02222; phosphoinositide phospholipase C 2. cd13363. Location:18 → 133. PH_PLC_delta; Phospholipase C-delta (PLC-delta) ... This gene encodes a member of the delta class of phospholipase C enzymes. Phospholipase C enzymes play a critical role in many ... PLCD4 phospholipase C delta 4 [Homo sapiens] PLCD4 phospholipase C delta 4 [Homo sapiens]. Gene ID:84812 ...
Membrane Association Allosterically Regulates Phospholipase A2 Enzymes and Their Specificity
Phospholipase A1 (PLA1) hydrolyzes phospholipid acyl chains at the sn-1 position of membrane phospholipids, phospholipase A2 ( ... and phospholipase D (PLD) hydrolyzes the polar group-phosphodiester bond. Of the phospholipases, the PLA2s have been the most ... Membrane Association Allosterically Regulates Phospholipase A2 Enzymes and Their Specificity Acc Chem Res. 2022 Dec 6;55(23): ... PLA2) hydrolyzes acyl chains at the sn-2 position, phospholipase C (PLC) hydrolyzes the glycerol-phosphodiester bond, ...
Molecular characteristics of horse phospholipase C zeta (PLCzeta) | Department of Veterinary and Animal Sciences
RCSB PDB - 4HYQ: Crystal structure of phospholipase A1 from Streptomyces albidoflavus NA297
Crystal structure of phospholipase A1 from Streptomyces albidoflavus NA297 ... phospholipase A1. A. 236. Streptomyces albidoflavus. Mutation(s): 0 Gene Names: PLA1, C0Q92_26465, Salbus254_5377, XNRR2_5106. ... Crystal structure of phospholipase A1 from Streptomyces albidoflavus NA297. Murayama, K., Kano, K., Matsumoto, Y., Sugimori, D. ... The metal-independent lipase from Streptomyces albidoflavus NA297 (SaPLA1) is a phospholipase A1 as it preferentially ...
Lithium activates brain phospholipase A2 and improves memory in rats: implications for Alzheimer's disease | SpringerLink
Phospholipase A2 (Pla2) is required for memory retrieval, and its inhibition in the hippocampus has been reported to impair ... Lithium activates brain phospholipase A2 and improves memory in rats: implications for Alzheimers disease. *Fábio B. Mury1,2, ... Mury, F.B., da Silva, W.C., Barbosa, N.R. et al. Lithium activates brain phospholipase A2 and improves memory in rats: ... Phospholipase A2 (Pla2) is required for memory retrieval, and its inhibition in the hippocampus has been reported to impair ...
Activity of phospholipase A2 | Gut
Our requirements are stated in our rapid response terms and conditions and must be read. These include ensuring that: i) you do not include any illustrative content including tables and graphs, ii) you do not include any information that includes specifics about any patients,iii) you do not include any original data, unless it has already been published in a peer reviewed journal and you have included a reference, iv) your response is lawful, not defamatory, original and accurate, v) you declare any competing interests, vi) you understand that your name and other personal details set out in our rapid response terms and conditions will be published with any responses we publish and vii) you understand that once a response is published, we may continue to publish your response and/or edit or remove it in the future ...
SCOPe 2.08: Superfamily d.136.1: Phospholipase D/nuclease
More info for Superfamily d.136.1: Phospholipase D/nuclease. Timeline for Superfamily d.136.1: Phospholipase D/nuclease: * ... d.136.1.2: Phospholipase D [64391] (1 protein). duplication: contains two domains of this fold arranged as in the Nuc dimer. ... Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily). beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: ... Lineage for Superfamily d.136.1: Phospholipase D/nuclease. *Root: SCOPe 2.08 *. Class d: Alpha and beta proteins (a+b) [53931 ...
Molecular interactions of phospholipid monolayers with a model phospholipase - Soft Matter (RSC Publishing)
The intrinsic overexpression of secretory phospholipase A2 (sPLA2) in various pro-inflammatory diseases and cancers has the ... Molecular interactions of phospholipid monolayers with a model phospholipase P. Zhang, V. Villanueva, J. Kalkowski, C. Liu, A. ... The intrinsic overexpression of secretory phospholipase A2 (sPLA2) in various pro-inflammatory diseases and cancers has the ...
phospholipase D activator activity Antibodies | Invitrogen ...
Phospholipase C beta Summary Report | CureHunter
It is structurally related to PHOSPHOLIPASE C DELTA with the addition of C-terminal extension of 400 residues. ... A phosphoinositide phospholipase C subtype that is primarily regulated by its association with HETEROTRIMERIC G-PROTEINS. ... Phospholipase C beta2; Phospholipase C beta3; Phospholipase C beta4; Phospholipase C-beta; Phospholipase C-beta1; Phospholipase ... Phospholipases: 1677*Type C Phospholipases: 869*Phosphoinositide Phospholipase C: 92*Phospholipase C beta: 86*C elegans Egl-8 ...
Phospholipase C Gamma 2 Phosphatidylinositol Specific PLCg2
... Polyclonal Antibody Human HRP - Gentaur.com - Product info ... Phospholipase C g 2, Phosphatidylinositol Specific (phospholipase C, gamma 2 (phosphatidylinositol-specific)) polyclonal ( ... Phospholipase C Gamma 2, Phosphatidylinositol Specific (PLCg2) Polyclonal Antibody (Human), FITC Catalog number: PAD841Hu01-1ml ... Phospholipase C Gamma 2, Phosphatidylinositol Specific (PLCg2) Polyclonal Antibody (Human), HRP Catalog number: PAD841Hu01-20ul ...
PLAZA 3.0 Dicots MapMan : 11.9.3.4 (lipid metabolism.lipid degradation.lysophospholipases.phospholipase A2)
Phospholipase Inhibitors - AG Scientific
Muscarinic Receptor Activation Promotes the Membrane Association of Tubulin for the Regulation of Gq-Mediated Phospholipase Cβ1...
1996) Activation of phospholipase Cγ by the concerted action of tau proteins and arachidonic acid. J Biol Chem 271:18342-18349. ... 1990) The actin-binding protein profilin binds to PIP2 and inhibits its hydrolysis by phospholipase C. Science 247:1575-1578. ... 1994) Effect of monolayer surface pressure on the activities of phosphoinositide-specific phospholipase C-β1, -γ1, and -δ1. ... 1992) Effects of gelsolin on human platelet cytosolic phosphoinositide-phospholipase C isozymes. J Biol Chem 267:6488-6494. ...
Phospholipase PLA2G6, a Parkinsonism-Associated Gene, Affects Vps26 and Vps35, Retromer Function, and Ceramide Levels, Similar...
Phospholipase PLA2G6, a Parkinsonism-Associated Gene, Affects Vps26 and Vps35, Retromer Function, and Ceramide Levels, Similar ... Phospholipases typically hydrolyze glycerol phospholipids, but loss of iPLA2-VIA does not affect the phospholipid composition ...
Human Metabolome Database: Showing Protein Group XIIB secretory phospholipase A2-like protein (HMDBP00062)
Showing Protein Group XIIB secretory phospholipase A2-like protein (HMDBP00062). IdentificationBiological propertiesGene ... Rouault M, Bollinger JG, Lazdunski M, Gelb MH, Lambeau G: Novel mammalian group XII secreted phospholipase A2 lacking enzymatic ... Group XIIB secretory phospholipase A2-like protein MKLASGFLVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGK ...
Phospholipase -An enzyme that is sensitive to the physics of its substrate | EPL
Phospholipase A2 activating peptide - ALX-165-007 - Enzo Life Sciences
AK106-001616, a Potent and Selective Inhibitor of Cytosolic Phospholipase A2: In Vivo Efficacy for Inflammation, Neuropathic...
independent phospholipase A2β. LOX. lipoxygenase. LPS. lipopolysaccharide. LT. leukotriene. LTB4. leukotriene B4. LTE4. ... phospholipase A2. RA. rheumatoid arthritis. RBL-2H3. rat basophilic leukemia 2H3. SD. Sprague-Dawley. sPLA2. secretory ... cytosolic phospholipase A2. CV. cardiovascular. GI. gastrointestinal. IPF. idiopathic pulmonary fibrosis. iPLA2β. ... 2003) Cytosolic phospholipase A2α-deficient mice are resistant to collagen-induced arthritis. J Exp Med 197:1297-1302. ...
Studies of the interfacial and heparin binding properties of secreted phospholipases A2 - ePrints Soton
Baker, Sharon Felicity (1998) Studies of the interfacial and heparin binding properties of secreted phospholipases A2. ... Human non-pancreatic secreted phospholipase A2 (hnps PLA2) is a small (14 kDa) secreted protein of considerable biomedical ... Human non-pancreatic secreted phospholipase A2 (hnps PLA2) is a small (14 kDa) secreted protein of considerable biomedical ... Studies of the interfacial and heparin binding properties of secreted phospholipases A2 ...
Go to Cyclin A2 modulates EMT via beta-catenin and phospholipase C pathways.
Cyclin A2 modulates EMT via beta-catenin and phospholipase C pathways. Cheung, C. T.; Bendris, N.; Paul, C.; Hamieh, A.; Anouar ... This suggests that a WNT-independent mechanism of beta-catenin activation via phospholipase C is involved in the EMT induced by ... Type C Phospholipases/genetics/*metabolism; Wnt Signaling Pathway/drug effects ... porcupine inhibitor C59 did not reverse EMT whereas a dominant negative form of TCF4 as well as inhibition of phospholipase C ...
Somatostatin Increases Phospholipase D Activity and Phosphatidylinositol 4,5-bisphosphate Synthesis in Clonal β Cells HIT-T15 |...
Somatostatin Increases Phospholipase D Activity and Phosphatidylinositol 4,5-bisphosphate Synthesis in Clonal β Cells HIT-T15. ... Somatostatin Increases Phospholipase D Activity and Phosphatidylinositol 4,5-bisphosphate Synthesis in Clonal β Cells HIT-T15. ... Somatostatin Increases Phospholipase D Activity and Phosphatidylinositol 4,5-bisphosphate Synthesis in Clonal β Cells HIT-T15. ... Somatostatin Increases Phospholipase D Activity and Phosphatidylinositol 4,5-bisphosphate Synthesis in Clonal β Cells HIT-T15 ...
Raised serum activity of phospholipase A2 immunochemically related to group II enzyme in inflammatory bowel disease: its...
The phospholipase A2 activity was significantly raised in those sera of the patients with active Crohns disease and those with ... The major phospholipase A2 activity derived from the sera was separated into two peaks by reverse phase high performance liquid ... Serum phospholipase A2 activity in patients with ulcerative colitis tends to increase in relation with endoscopic severity, and ... Calcium dependent phospholipase A2 activity in the mixed micelles of 1-palmitoyl-2-oleoyl-phosphatidylglycerol and cholate was ...
Studies on phospholipase A in Trimeresurus flavoviridis venom. 3. Purification and some properties of phospholipase A inhibitor...
3. Purification and some properties of phospholipase A inhibitor in habu se ... Studies on phospholipase A in Trimeresurus flavoviridis venom. ... Kihara, H. 1976: Studies on phospho lipase a ec 3.1.1.4 in ... Studies on phospholipase A in Trimeresurus flavoviridis venom. 3. Purification and some properties of phospholipase A inhibitor ... Purification, some properties and amino acid sequence of a phospholipase A2 (DE-I) from Trimeresurus okinavensis (Hime-habu) ...
PUBLICACION Differential postmortem delay effect on agonist mediated phospholipase Cbeta activity in human cortical crude and...
Differential postmortem delay effect on agonist-mediated phospholipase Cbeta activity in human cortical crude and synaptosomal ... PUBLICACION_Differential_postmortem_delay_effect_on_agonist_mediated_phospholipase_Cbeta_activity_in_human_cortical_crude_and_ ... Differential postmortem delay effect on agonist-mediated phospholipase Cbeta activity in human cortical crude and synaptosomal ...
Secreted group IIA phospholipase A2 protects humans against the group B streptococcus: experimental and clinical evidence -...
Phospholipase C signalling in cutaneous squamous cell carcinoma
Secreted phospholipase A2 of Clonorchis sinensis activates hepatic stellate cells through a pathway involving JNK signalling |...
Phospholipase A2 is well known for its role in liver fibrosis and inhibition of tumour cells. The JNK signalling pathway is ... Secreted phospholipase A2 (sPLA2) is a protein secreted by Clonorchis sinensis and is a component of excretory and secretory ... Secreted phospholipase A2 (sPLA2) is a protein secreted by C. sinensis and is a component of CsESPs. sPLA2 enzymes, ... Secreted phospholipase A2 (sPLA2) is a protein secreted by Clonorchis sinensis and is a component of excretory and secretory ...