*  Peptide YY Antibody (1) - BSA Free (NBP1-05167): Novus Biologicals
Mouse Monoclonal Anti-Peptide YY Antibody (1) - BSA Free. Validated: ELISA, IHC, IHC-P. Tested Reactivity: Human. 100% ... Home » Peptide YY » Peptide YY Antibodies » Peptide YY Antibody (1) - BSA Free ... Blogs on Peptide YY. There are no specific blogs for Peptide YY, but you can read our latest blog posts. ... Reviews for Peptide YY Antibody (NBP1-05167) (0) There are no reviews for Peptide YY Antibody (NBP1-05167). By submitting a ...
  https://www.novusbio.com/products/peptide-yy-antibody-1_nbp1-05167
*  Peptide YY - Wikipedia
Peptide YY (PYY) also known as peptide tyrosine tyrosine is a peptide that in humans is encoded by the PYY gene. Peptide YY is ... Peptide YY can be produced as the result of enzymatic breakdown of crude fish proteins and ingested as a food product. Peptide ... The two major forms of peptide YY are PYY1-36 and PYY3-36, which have PP fold structural motifs. However, the most common form ... YY is related to the pancreatic peptide family by having 18 of its 36 amino acids located in the same positions as pancreatic ...
  https://en.wikipedia.org/wiki/Peptide_YY
*  Neuropeptide Y and Peptide YY Peptides - Neuropeptides | Sigma-Aldrich
Neuropeptide Y (NPY) is a 36 amino acid peptide that is highly homologous to peptide YY (PYY). NPY exerts its various ... Peptides for Cell Biology > Neuropeptides > Neuropeptide Y and Peptide YY Peptides ... Neuropeptide Y (NPY) is a 36 amino acid peptide that is highly homologous to peptide YY (PYY). NPY exerts its various ... USA Home > Product Directory > Cell Biology > Cell Signaling and Neuroscience > Peptides and Proteins > ...
  https://www.sigmaaldrich.com/life-science/cell-biology/cell-biology-products.html?TablePage=9551691
*  Obesity hormone peptide YY - Stock Image A619/0095 - Science Photo Library
Molecular model of part of the hormone peptide YY (or PYY3-36), a hormone that helps to regulate appetite. It is released by ... Caption: Obesity hormone peptide YY. Molecular model of part of the hormone peptide YY (or PYY3-36), a hormone that helps to ... peptide yy, person, polypeptide, protein, proteins, pyy3-36, structural, structure Licence fees: A licence fee will be charged ...
  http://www.sciencephoto.com/media/7797/view
*  Gastrointestinal Peptide Binding and Function in the Brain: Emphasis on Peptide YY | SpringerLink
... a large number of gastrointestinal peptides have been found in the brain, some of which fulfill criteria established for ... Inui A., Baba S. (1990) Gastrointestinal Peptide Binding and Function in the Brain: Emphasis on Peptide YY. In: Müller E.E., ... Tatemoto K, Carlquist M, Mutt V (1982) Neuropeptide Y - a novel brain peptide with structural similarities to peptide YY and ... Andrews PC, Hawke D, Shively JE, Dixon JE (1985) A nonamidated peptide homologous to porcine peptide YY and neuropeptide Y. ...
  https://link.springer.com/chapter/10.1007/978-1-4612-3446-3_5
*  The Role of Peptide YY (PYY)in Inhibiting Food Intake. - Full Text View - ClinicalTrials.gov
The Role of Peptide YY (PYY)in Inhibiting Food Intake.. The safety and scientific validity of this study is the responsibility ...
  https://clinicaltrials.gov/show/NCT00259233
*  Sweet Taste Receptors and the Secretion of Glucagon-like Peptide-1 and Peptide YY - Full Text View - ClinicalTrials.gov
Sweet Taste Receptors and the Secretion of Glucagon-like Peptide-1 and Peptide YY. The safety and scientific validity of this ... The Functional Significance of Gut-expressed Taste Receptors in the Secretion of Glucagon-like Peptide-1 and Peptide YY. ... and peptide YY (PYY). Several nutrient responsive G-protein coupled receptors have been identified in the human gut, including ... Glucagon-Like Peptide 1. Gastrointestinal Agents. Hormones. Hormones, Hormone Substitutes, and Hormone Antagonists. ...
  https://clinicaltrials.gov/ct2/show/NCT01088841
*  Safety, Toleration and Pharmacokinetics of Single Intravenous Doses of Peptide YY in Overweight Adults - Full Text View -...
Safety, Toleration and Pharmacokinetics of Single Intravenous Doses of Peptide YY in Overweight Adults. This study has been ... The purpose of this trial is to evaluate the safety and tolerability of single escalating doses of Peptide YY3-36 and to ... Pharmacokinetics And Pharmacodynamics Of Single Escalating Doses Of Intravenous Peptide YY3-36 In Otherwise Healthy Overweight ...
  https://clinicaltrials.gov/ct2/show/NCT00331175?term=peptide+yy+and+obesity&rank=3
*  Bidirectional GPR119 Agonism Requires Peptide YY and Glucose for Activity in Mouse and Human Colon Mucosa, Endocrinology | 10...
"Bidirectional GPR119 Agonism Requires Peptide YY and Glucose for Activity in Mouse and Human Colon Mucosa, Endocrinology" on ... glucagonlike peptide 1 (GLP-1), peptide YY (PYY), and glucose-dependent insulinotropic peptide (GIP) (3, 8-10). Additionally, ... glucagonlike peptide 1 (GLP-1), peptide YY (PYY), and glucose-dependent insulinotropic peptide (GIP) (3, 8-10). Additionally, ... peptide YY (PYY) and glucagonlike peptide 1, and insulin, respectively. Endogenous oleoylethanolamide (OEA) and the dietary ...
  https://www.deepdyve.com/lp/ou_press/bidirectional-gpr119-agonism-requires-peptide-yy-and-glucose-for-v9I0oz4KWo
*  "Increases in peptide Y-Y levels following oat β-glucan ingestion are d" by Eleanor J. Beck, Linda C. Tapsell et al.
Peptide Y-Y (PYY) is an anorexigenic hormone implicated in appetite control, and β-glucan is a fiber known to affect appetite. ... Peptide Y-Y (PYY) is an anorexigenic hormone implicated in appetite control, and β-glucan is a fiber known to affect appetite. ... Beck, E. J., Tapsell, L. C., Batterham, M. J., Tosh, S. M. & Huang, X. (2009). Increases in peptide Y-Y levels following oat β- ... Increases in peptide Y-Y levels following oat β-glucan ingestion are dose-dependent in overweight adults ...
  http://ro.uow.edu.au/smhpapers/5/
*  Peptide YY
... peptide YY, glucagon-like peptide 1, and glucagon-like peptide 2 concentrations compared with gastric feeding in vivo in humans ... Data suggest plasma PYY (peptide YY) and GLP1 (glucagon-like peptide 1) can be regulated by digestion-resistant diet factors; ... peptide YY), and GLP-1/2 (glucagon-like peptides 1/2) concentrations being attained after jejunal feeding.. ... Plant-rich mixed meals based on Palaeolithic diet principles have a dramatic impact on incretin, peptide YY and satiety ...
  https://pharos.nih.gov/idg/targets/P10082
*  Effects of peptide YY (PYY) on mouth to caecum intestinal transit time and on the rate of gastric emptying in healthy...
Effects of peptide YY (PYY) on mouth to caecum intestinal transit time and on the rate of gastric emptying in healthy ... Effects of peptide YY (PYY) on mouth to caecum intestinal transit time and on the rate of gastric emptying in healthy ... The effect of an infusion of two doses of peptide YY (PYY), a novel putative gastrointestinal hormone, has been assessed on ... of mouth to caecum intestinal transit time and of the rate of gastric emptying and suggests this novel hormonal peptide to be ...
  http://gut.bmj.com/content/28/2/166
*  SBP0242 - Peptide YY, human : Severn Biotech, Limited
Peptide YY, human MW: 4310.4 H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu- ... Home :: Catalogue Peptides :: Peptide YY (PYY) and Related Pep :: SBP0242 - Peptide YY, human ... SBP0242 - Peptide YY, human. MW: 4310.4. H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr- ...
  http://www.severnbiotech.com/index.php?main_page=product_info&cPath=109_167&products_id=746
*  The Association of Serum Total Peptide YY (PYY) with Obesity and Body Fat Measures in the CODING Study - Memorial University...
The Association of Serum Total Peptide YY (PYY) with Obesity and Body Fat Measures in the CODING Study ... The Association of Serum Total Peptide YY (PYY) with Obesity and Body Fat Measures in the CODING Study ... The Association of Serum Total Peptide YY (PYY) with Obesity and Body Fat Measures in the CODING Study. PLoS ONE, 9 (4). ISSN ...
  http://research.library.mun.ca/6440/
*  How To Stop Feeling Hungry All The Time - mindbodygreen
6. Peptide YY (PYY), the 'Control' Hormone: Its role: PYY is the control hormone in the gastrointestinal tract that reduces ...
  https://www.mindbodygreen.com/articles/how-to-stop-feeling-hungry-all-the-time-hunger-hormones-kelly-leveque
*  Glucagon-like peptide-2 - Wikipedia
Peptide YY. *Peptide YY (3-36). *Antagonists: BIIE-0246. *JNJ-5207787. *SF-11 ... Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see ... post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 ( ... Retrieved from "https://en.wikipedia.org/w/index.php?title=Glucagon-like_peptide-2&oldid=653471146" ...
  https://en.wikipedia.org/wiki/Glucagon-like_peptide_2
*  Telcagepant - Wikipedia
Peptide YY. *Peptide YY (3-36). *Antagonists: BIIE-0246. *JNJ-5207787. *SF-11 ... Telcagepant (INN) (code name MK-0974) is a calcitonin gene-related peptide receptor antagonist which was an investigational ... "Efficacy and tolerability of MK-0974 (telcagepant), a new oral antagonist of calcitonin gene-related peptide receptor, ...
  https://en.wikipedia.org/wiki/Telcagepant
*  Cholecystokinin B receptor - Wikipedia
Peptide YY. *Peptide YY (3-36). *Antagonists: BIIE-0246. *JNJ-5207787. *SF-11 ... This gene encodes a G protein-coupled receptor for gastrin and cholecystokinin (CCK),[7][8][9] regulatory peptides of the brain ... Harikumar KG, Clain J, Pinon DI, Dong M, Miller LJ (Jan 2005). "Distinct molecular mechanisms for agonist peptide binding to ... "A single amino acid of the cholecystokinin-B/gastrin receptor determines specificity for non-peptide antagonists". Nature. 362 ...
  https://en.wikipedia.org/wiki/Cholecystokinin_B_receptor
*  Gonadotropin preparations - Wikipedia
Peptide YY. *Peptide YY (3-36). *Antagonists: BIIE-0246. *JNJ-5207787. *SF-11 ...
  https://en.wikipedia.org/wiki/Gonadotropin_Preparations
*  Parathyroid hormone-related protein - Wikipedia
Peptide YY. *Peptide YY (3-36). *Antagonists: BIIE-0246. *JNJ-5207787. *SF-11 ... peptide hormone receptor binding. • hormone activity. Cellular component. • extracellular region. • cell nucleus. • Golgi ... Identification of a novel parathyroid hormone-like peptide". The New England Journal of Medicine. 319 (9): 556-63. doi:10.1056/ ... Miao D, Li J, Xue Y, Su H, Karaplis AC, Goltzman D (August 2004). "Parathyroid hormone-related peptide is required for ...
  https://en.wikipedia.org/wiki/Parathyroid_hormone-related_protein
*  Neurotransmitter - Wikipedia
Peptide YY. PYY. -. -. PP: Opioids. Enkephalin. δ-Opioid receptor. -. PP: Opioids. Dynorphin. κ-Opioid receptor. -. ... Vasoactive intestinal peptide. VIP. Vasoactive intestinal peptide receptors. -. PP: Secretins. Growth hormone-releasing hormone ... Peptides: somatostatin, substance P, cocaine and amphetamine regulated transcript, opioid peptides[9] ... List of neurotransmitters, peptides, and gasotransmitters[edit]. This list is incomplete; you can help by expanding it. ...
  https://en.wikipedia.org/wiki/Neuro_transmitter
*  Combinatorial depletion analysis to assemble the network architecture of the SAGA and ADA chromatin remodeling complexes |...
Lin YY, Qi Y, Lu JY, Pan X, Yuan DS, Zhao Y, Bader JS, Boeke JD (2008) A comprehensive synthetic genetic interaction network ... Combining all runs, proteins had to be detected by at least two such peptides, or one peptide with two independent spectra. ... Zhang Y, Wen Z, Washburn MP, Florens L (2010) Refinements to label free proteome quantitation: how to deal with peptides shared ... Eng JK, McCormack AL, Yates III JR (1994) An approach to correlate tandem mass spectral data of peptides with amino acid ...
  http://msb.embopress.org/content/7/1/503
*  IL-8 Plasma Concentrations and the Risk of Future Coronary Artery Disease in Apparently Healthy Men and Women |...
Pearson TA, Mensah GA, Alexander RW, Anderson JL, Cannon RO 3rd, Criqui M, Fadl YY, Fortmann SP, Hong Y, Myers GL, Rifai N, ... Schroder JM, Christophers E. Secretion of novel and homologous neutrophil-activating peptides by lipopolysaccharide (LPS)- ...
  http://atvb.ahajournals.org/content/24/8/1503.long