Loading...
*  The major vault protein is responsive to and interferes with interferon-γ-mediated STAT1 signals | Journal of Cell Science
Broad distribution of the multidrug resistance-related vault lung resistance protein in normal human tissues and tumors. Am. J ... Protein concentration was determined with the Micro BCA protein assay reagent kit (Pierce, Rockford, IL). The protein content ... Increased expression of multidrug resistance related proteins Pgp, MRP1, and LRP/MVP occurs early in colorectal carcinogenesis ... Lange, C., Walther, W., Schwabe, H. and Stein, U. (2000). Cloning and initial analysis of the human multidrug resistance- ...
  http://jcs.biologists.org/content/119/3/459
*  Overexpression of adenosine triphosphate-binding cassette (ABC) transport proteins is emerging seeing | Novel EGFR inhibitors...
... and Riociguat could end up being a competent agent for preventing and reversing multi-drug resistance in breast malignancy. (11 ... The eukaryotic initiation factor (eIF) 4F complex consists of three proteins: cap-binding protein eIF4E, scaffolding protein ... Cell lysates had been quantified for proteins content utilizing a bicinchoninic acid proteins. ... transport proteins is emerging seeing that a crucial contributor to anticancer medication level of resistance. assays. eIF4G ...
  http://paft-phil.com/overexpression-of-adenosine-triphosphate-binding-cassette-abc-transport-proteins-is-emerging-seeing/
*  Vault RNA - Wikipedia
"The non-coding RNA of the multidrug resistance-linked vault particle encodes multiple regulatory small RNAs". Nat Cell Biol. 11 ... The vault complex comprises the major vault protein (MVP), two minor vault proteins (VPARP and TEP1), and a variety of small ... While vault proteins appear to be present in a variety of organisms, vaults isolated from higher eukaryotes contain a small ... Vault proteins, but not the vtRNA, have also been found in sea urchin, Dictyostelium discoideum and Acanthamoeba. As the field ...
  https://en.wikipedia.org/wiki/Vault_RNA
*  Multidrug resistance protein MdtK (B1LEM1) | InterPro | EMBL-EBI
We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their ... InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites ... Protein family membership. *Multi antimicrobial extrusion protein (IPR002528)*Multidrug resistance protein MdtK (IPR022913) ...
  http://www.ebi.ac.uk/interpro/protein/B1LEM1
*  Multidrug resistance-associated protein 5 (IPR030238) | InterPro | EMBL-EBI
We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their ... InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites ... This entry represents the multidrug resistance-associated protein 5 (MRP5 or ABCC5). It belongs to the MRP (multidrug ... Multidrug-resistance protein 5 is a multispecific organic anion transporter able to transport nucleotide analogs.. Proc. Natl. ...
  http://www.ebi.ac.uk/interpro/entry/IPR030238
*  Multidrug resistance-associated protein 1 - DrugBank
Multidrug resistance-associated protein 1. Details. Name. Multidrug resistance-associated protein 1. Synonyms. *ATP-binding ... lcl,BSEQ0010554,Multidrug resistance-associated protein 1 (ABCC1) ATGGCGCTCCGGGGCTTCTGCAGCGCCGATGGCTCCGACCCGCTCTGGGACTGGAATGTC ... lcl,BSEQ0037076,Multidrug resistance-associated protein 1 MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRH ... Confers resistance to anticancer drugs. Hydrolyzes ATP with low efficiency.. Pfam Domain Function. *ABC_tran (PF00005) ...
  https://www.drugbank.ca/biodb/polypeptides/P33527
*  Multidrug Resistance Protein-4 Influences Aspirin Toxicity in Human Cell Line
... Isabella Massimi,1 Ambra Ciuffetta,2 Flavia ... Isabella Massimi, Ambra Ciuffetta, Flavia Temperilli, et al., "Multidrug Resistance Protein-4 Influences Aspirin Toxicity in ...
  https://www.hindawi.com/journals/mi/2015/607957/cta/
*  Multidrug Resistance-Associated Proteins Summary Report | CureHunter
Overexpression of proteins in this class by NEOPLASMS is considered a possible mechanism in the development of multidrug ... resistance (DRUG RESISTANCE, MULTIPLE). Although similar in function to P-GLYCOPROTEINS, the proteins in this class share ... a subset of proteins in this family have also been shown to convey drug resistance to neutral organic drugs. Their cellular ... Multidrug Resistance-Associated Proteins: A sequence-related subfamily of ATP-BINDING CASSETTE TRANSPORTERS that actively ...
  http://www.curehunter.com/public/keywordSummaryD027425-Multidrug-Resistance-Associated-Proteins.do
*  Portrait of multifaceted transporter, the multidrug resistance-associated protein 1 (MRP1/ABCC1) | SpringerLink
This protein has an unusually broad substrate specificity and is capable of transporting not only a wide... ... multidrug resistance protein 1 (P-glycoprotein, ABCB1), ABCB-type protein. MDR3. multidrug resistance protein 3 (ABCB4), ABCB- ... Multidrug resistance markers P-glycoprotein, multidrug resistance protein 1, and lung resistance protein in non-small cell lung ... multidrug resistance related protein-1, and lung resistance-related protein expression. Nucl Med Biol 30:627-632PubMedGoogle ...
  https://link.springer.com/article/10.1007%2Fs00424-006-0160-8
*  Small multidrug resistance protein - Wikipedia
Small multidrug resistance protein is a family of integral membrane proteins that confer drug resistance to a wide range of ... "Cloning and characterization of the mvrC gene of Escherichia coli K-12 which confers resistance against methyl viologen ...
  https://en.wikipedia.org/wiki/Small_multidrug_resistance_protein
*  Multidrug resistance-associated protein 2 - Wikipedia
2001). "Impaired protein maturation of the conjugate export pump multidrug resistance protein 2 as a consequence of a deletion ... this protein is a member of the MRP subfamily, which is involved in multi-drug resistance. This protein is expressed in the ... 1999). "The human multidrug resistance protein 2 gene: functional characterization of the 5'-flanking region and expression in ... Bakos E, Evers R, Sinkó E, Váradi A, Borst P, Sarkadi B (April 2000). "Interactions of the human multidrug resistance proteins ...
  https://en.wikipedia.org/wiki/Multidrug_resistance-associated_protein_2
*  Verapamil and its derivative trigger apoptosis through glutathione extrusion by multidrug resistance protein MRP1.
... behave as apoptogens in multidrug resistance protein 1 (MRP1)-expressing cells. When treated with either verapamil or NMeOHI(2 ... Multidrug Resistance-Associated Proteins / genetics, metabolism*. Transfection. Verapamil / analogs & derivatives, pharmacology ... 0/Multidrug Resistance-Associated Proteins; 0/alpha-(3-((2-(4-hydroxy-3,5-diiodophenyl)ethyl)methylamino)propyl) -3,4-dimethoxy ... 0/multidrug resistance-associated protein 1; 52-53-9/Verapamil; 70-18-8/Glutathione; 72025-60-6/Leukotriene C4 ...
  http://www.biomedsearch.com/nih/Verapamil-its-derivative-trigger-apoptosis/15256468.html
*  Multidrug resistance-associated protein 4 | definition of multidrug resistance-associated protein 4 by Medical dictionary
What is multidrug resistance-associated protein 4? Meaning of multidrug resistance-associated protein 4 medical term. What does ... Looking for online definition of multidrug resistance-associated protein 4 in the Medical Dictionary? multidrug resistance- ... Multidrug resistance-associated protein 4 , definition of multidrug resistance-associated protein 4 by Medical dictionary https ... redirected from multidrug resistance-associated protein 4) ABCC4. A gene on chromosome 13q32 that encodes a protein of the MRP ...
  http://medical-dictionary.thefreedictionary.com/multidrug+resistance-associated+protein+4
*  Functional Expression of the Multidrug Resistance Protein 1 in Microglia | Journal of Pharmacology and Experimental Therapeutics
... multidrug resistance protein; hMRP1, human multidrug resistant protein 1; rMRP1, rat multidrug resistance protein 1; HIV-1, ... cloned the first multidrug resistance gene, the product of which is now commonly referred to as the multidrug resistance ... Borst P, Evers R, Kool M, and Wijnholds J (1999) The multidrug resistance protein family. Biochim Biophys Acta 1461: 347-357. ... Functional Expression of the Multidrug Resistance Protein 1 in Microglia. Shannon Dallas, Xiaoping Zhu, Sylvain Baruchel, ...
  http://jpet.aspetjournals.org/content/307/1/282
*  multidrug resistance protein 3 - Semantic Scholar
multidrug resistance protein 3. Known as: MDR3 protein, PGY3 protein, mdr-3 protein ... Intestinal breast cancer resistance protein (BCRP)/Bcrp1 and multidrug resistance protein 3 (MRP3)/Mrp3 are involved in the ... The multidrug resistance protein (MRP) family belongs to the ATP-binding cassette superfamily (ABC) of transporters, which are ... Induction of multidrug resistance protein 3 in rat liver is associated with altered vectorial excretion of acetaminophen ...
  https://www.semanticscholar.org/topic/multidrug-resistance-protein-3/834118
*  Functional Expression of the Multidrug Resistance Protein 1 (MRP1) in Microglia | Journal of Pharmacology and Experimental...
Functional Expression of the Multidrug Resistance Protein 1 (MRP1) in Microglia. Shannon Dallas, Xiaoping Zhu, Sylvain Baruchel ... Functional Expression of the Multidrug Resistance Protein 1 (MRP1) in Microglia. Shannon Dallas, Xiaoping Zhu, Sylvain Baruchel ... Functional Expression of the Multidrug Resistance Protein 1 (MRP1) in Microglia. Shannon Dallas, Xiaoping Zhu, Sylvain Baruchel ... Functional Expression of the Multidrug Resistance Protein 1 (MRP1) in Microglia Message Subject (Your Name) has forwarded a ...
  http://jpet.aspetjournals.org/content/early/2003/07/31/jpet.103.054304
*  mdlB - Multidrug resistance-like ATP-binding protein MdlB - Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) - mdlB...
sp,Q8K984,MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum ( ... to allow unambiguous identification of a protein.,p>,a href='/help/protein_names' target='_top'>More...,/a>,/p>Protein namesi. ... Protein. Similar proteins. Organisms. Length. Cluster ID. Cluster name. Size. Q8K984. P57552. UPI000005E5CC. UPI000189C5E5. ... PROSITE; a protein domain and family database. More...PROSITEi. View protein in PROSITE. PS50929. ABC_TM1F. 1 hit. PS00211. ABC ...
  http://www.uniprot.org/uniprot/Q8K984
*  Frontiers | Inhibition of multidrug resistance protein 1 (MRP1) improves chemotherapy drug response in primary and recurrent...
The presence of MK571 (inhibitor of MRP1 and Multidrug resistance protein 4 (MRP4) led to an enhanced effect of vincristine and ... The presence of MK571 (inhibitor of MRP1 and Multidrug resistance protein 4 (MRP4) led to an enhanced effect of vincristine and ... Increased expression of the multidrug resistance protein 1(MRP1) in high grade glioma, and it's role in BBB active transport, ... Increased expression of the multidrug resistance protein 1(MRP1) in high grade glioma, and it's role in BBB active transport, ...
  https://www.frontiersin.org/articles/10.3389/fnins.2015.00218/full
*  Evidence for two interacting ligand binding sites in human multidrug resistance protein 2 (ATP binding cassette C2). | Sigma...
Multidrug resistance protein 2 (MRP2) belongs to the ATP binding cassette family of transporters. Its substrates include ... Evidence for two interacting ligand binding sites in human multidrug resistance protein 2 (ATP binding cassette C2).. [Noam ...
  https://www.sigmaaldrich.com/catalog/papers/12702717
*  Casein Kinase 2α Regulates Multidrug Resistance-Associated Protein 1 Function via Phosphorylation of Thr249 | Molecular...
1996) Multidrug resistance mediated by the multidrug resistance protein (MRP) gene. Biochemical pharmacology 52:967-977. ... 2001) Role of multidrug resistance protein 1 (MRP1) and glutathione S-transferase A1-1 in alkylating agent resistance. Kinetics ... 1994) Overexpression of multidrug resistance-associated protein (MRP) increases resistance to natural product drugs. Cancer Res ... Within the ABC superfamily, ABCB1 (P-glycoprotein/multidrug resistance), ABCG2 (breast cancer resistance protein), and several ...
  http://molpharm.aspetjournals.org/content/82/3/488.long
*  Elevated Glutathione Is Not Sufficient to Protect against Doxorubicin-Induced Nuclear Damage in Heart in Multidrug Resistance...
2014) Lapatinib antagonizes multidrug resistance-associated protein 1-mediated multidrug resistance by inhibiting its transport ... 2001) Identification of an amino acid residue in multidrug resistance protein 1 critical for conferring resistance to ... multidrug resistance-associated protein 1. pAb. polyclonal antibody. ROS. reactive oxygen species. WT. wild type. ... Multidrug resistance associated protein 1 (Mrp1/Abcc1), a member of subfamily C of the ATP-binding cassette (ABC) transporters ...
  http://jpet.aspetjournals.org/content/355/2/272
*  Lapatinib Antagonizes Multidrug Resistance-Associated Protein 1-Mediated Multidrug Resistance by Inhibiting Its Transport...
Lapatinib Antagonizes Multidrug Resistance-Associated Protein 1-Mediated Multidrug Resistance by Inhibiting Its Transport ... multidrug resistance-associated protein 1 [MRP1]) and ABCG2 (breast cancer resistant protein [BCRP]) (3,4). These proteins ... 1999) Lung resistance-related protein: determining its role in multidrug resistance. J. Natl. Cancer Inst. 91:1604-5.CrossRef ... Cui Y, et al. (1999) Drug resistance and ATP-dependent conjugate transport mediated by the apical multidrug resistance protein ...
  https://rd.springer.com/article/10.2119%2Fmolmed.2014.00059
*  Multidrug Resistance-associated Protein Gene Overexpression and Reduced Drug Sensitivity of Topoisomerase II in a Human Breast...
Multidrug Resistance-associated Protein Gene Overexpression and Reduced Drug Sensitivity of Topoisomerase II in a Human Breast ... Multidrug Resistance-associated Protein Gene Overexpression and Reduced Drug Sensitivity of Topoisomerase II in a Human Breast ... Multidrug Resistance-associated Protein Gene Overexpression and Reduced Drug Sensitivity of Topoisomerase II in a Human Breast ... Multidrug Resistance-associated Protein Gene Overexpression and Reduced Drug Sensitivity of Topoisomerase II in a Human Breast ...
  http://cancerres.aacrjournals.org/content/54/1/152
*  RNA Expression of Breast Cancer Resistance Protein, Lung Resistance-related Protein, Multidrug Resistance-associated Proteins 1...
RNA Expression of Breast Cancer Resistance Protein, Lung Resistance-related Protein, Multidrug Resistance-associated Proteins 1 ... RNA Expression of Breast Cancer Resistance Protein, Lung Resistance-related Protein, Multidrug Resistance-associated Proteins 1 ... RNA Expression of Breast Cancer Resistance Protein, Lung Resistance-related Protein, Multidrug Resistance-associated Proteins 1 ... RNA Expression of Breast Cancer Resistance Protein, Lung Resistance-related Protein, Multidrug Resistance-associated Proteins 1 ...
  http://clincancerres.aacrjournals.org/content/9/2/827
*  5uja » Multidrug resistance protein 1 (MRP1), structure 2 - Orientations of Proteins in Membranes (OPM) database
5uja » Multidrug resistance protein 1 (MRP1), structure 2. 3D view in Jmol or Webmol Download Coordinates Topology in ... Species: Bos taurus (88 proteins). *Localization: Eukaryotic plasma membrane (885 proteins). 5uja » Multidrug resistance ...
  http://opm.phar.umich.edu/protein.php?pdbid=5uja