*  MHC Class I H-2 Kd antibody | acris-antibodies.com
MHC class I antigens are heterodimers consisting of one alpha chain (44kDa) with beta 2 microglobulin (11.5 kDa). The antigen ... Alternative names for MHC Class I H-2 Kd antibody. H-2K(D), H2-K1, H2-K, H-2 class I histocompatibility antigen, K-D alpha ... Background of MHC Class I H-2 Kd antibody. MHC Class I molecules play a central role in the immune system by presenting ...
  https://www.acris-antibodies.com/target/mhc-class-i-h-2-kd-antibody.htm
*  H-2 antigens | definition of H-2 antigens by Medical dictionary
What is H-2 antigens? Meaning of H-2 antigens medical term. What does H-2 antigens mean? ... Looking for online definition of H-2 antigens in the Medical Dictionary? H-2 antigens explanation free. ... antigens that are coded by the H-2 complex of genes in mice and are involved in self/nonself recognition. H-2 antigen system is ... H-2 antigens , definition of H-2 antigens by Medical dictionary https://medical-dictionary.thefreedictionary.com/H-2+antigens ...
  https://medical-dictionary.thefreedictionary.com/H-2+antigens
*  RCSB PDB - Protein Feature View - CD1-2 antigen - Q5GL29 (Q5GL29 CHICK)
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex assemblies. As a member of the wwPDB, the RCSB PDB curates and annotates PDB data according to agreed upon standards. The RCSB PDB also provides a variety of tools and resources. Users can perform simple and advanced searches based on annotations relating to sequence, structure and function. These molecules are visualized, downloaded, and analyzed by users who range from students to specialized scientists.
  http://www.rcsb.org/pdb/protein/Q5GL29
*  MHC Ib Qa-2 antigen Summary Report | CureHunter
... a nonclassical MHC Ib antigen implicated in innate & adaptive immune responses as well as in embryonic development ... Antigens: 114404*Surface Antigens: 4354*Histocompatibility Antigens: 1123*Histocompatibility Antigens Class I: 587*MHC Ib Qa-2 ... Histocompatibility Antigens: 1123*Histocompatibility Antigens Class I: 587*MHC Ib Qa-2 antigen ... a nonclassical MHC Ib antigen implicated in innate & adaptive immune responses as well as in embryonic development ...
  http://www.curehunter.com/public/keywordSummaryC448919-MHC-Ib-Qa-2-antigen.do
*  TANK Protein Human Recombinant | TRAF-2 Antigen | ProSpec
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term ...
  https://www.prospecbio.com/TRAF2_Human
*  The absence of H-2 antigens from mouse pancreatic beta-cells demonstrated by immunoferritin labeling. | JEM
The H-2 antigens of the dissociated pancreatic cells were labeled with an immunoferritin technique. Pancreatic duct epithelial ... Pancreatic beta-cells are therefore one of six known epithelial cell types on which H-2 antigens can not be detected by ... The apparent absence of H-2 antigens from these cells suggests a study of the viability of beta-cells in allografts of ... The absence of H-2 antigens from mouse pancreatic beta-cells demonstrated by immunoferritin labeling.. E L Parr ...
  http://jem.rupress.org/content/150/1/1
*  The American Journal of Tropical Medicine and Hygiene | Identification of Genes That Encode Fasciola-Specific Arc 2 Antigens
In the current study, the antibodies reacting with a subset of antigens in the 10-21-kD range were eluted from nitrocellulose ... each of which encode distinct antigens that may be used for the specific immunodiagnosis of fascioliasis. ... reveals a mosaic of antigens with molecular weights in the range of 10-43 kD. ... The finding of multiple genes supports the observation that F. hepatica arc 2 is a mosaic of antigens. The studies show that ...
  http://www.ajtmh.org/content/journals/10.4269/ajtmh.1994.51.684
*  Adenovirus Grade 2 antigen
Antigens. Application: IgG and IgM detection in ELISA (EIA) ... Buy Adenovirus Grade 2 antigen (MBS569098) product datasheet at ... Antigen. Biochemical. cDNA Clone. siRNA. Peptide. Rec./Purified Protein. Custom ELISA Kit. Custom Protein. Custom Antibody. ... UCP-2 ELISA Kit. • CEA ELISA Kit. • Influenza A HA H1 Antibody. • HLA-A ELISA Kit. • Fatty Acid Binding Protein-7 (FABP7) ... Applications Tested/Suitable for Adenovirus Grade 2 antigen IgG and IgM detection in ELISA (EIA). ...
  https://www.mybiosource.com/prods/Antigen/Adenovirus-Grade-2/datasheet.php?products_id=569098&cacheID=4fee1ae35938497e2121fb661b6fc17e
*  STAG2 (Stromal Antigen 2)
Stromal Antigen 2), Authors: Suning Chen, Stefan Nagel, Hans G Drexler, Roderick AF MacLeod. Published in: Atlas Genet ... STAG2 (Stromal Antigen 2). Written. 2013-09. Suning Chen, Stefan Nagel, Hans G Drexler, Roderick AF MacLeod. ... 2/64) of CML, and 1.3% (1/77) of MPN: the STAG2 alterations were mostly exclusive with alterations involving other components ...
  http://atlasgeneticsoncology.org/Genes/GC_STAG2.html
*  Site Directed Mutagenesis Identifies Allo-Antigenic Epitopes of an H-2 Antigen Recognized by Antibodies and by Cytotoxic T...
To test our previous hypothesis that the segment between amino acid position 63 to 73 of the H-2Dd antigen forms a major allo- ... Monoclonal antibodies to mouse MHC antigens. II. Antibodies to the H-2Ld antigen, the products of a third polymorphic locus of ... 70 and 73 of the H-2Ld antigen with those of the H-2Dd antigen. Gain and loss of serological and CTL epitopes specific for the ... An alto CTL epitope of the H-2Dd antigen was also localized to this stretch of amino acid sequence, as one of several H-2Dd ...
  https://link.springer.com/chapter/10.1007/978-1-4757-0764-9_17
*  Early prostate cancer antigen-2 - Wikipedia
Early prostate cancer antigen-2 (EPCA-2) is a protein of which blood levels are elevated in prostate cancer. It appears to ... "Detection of prostate cancer with a blood-based assay for early prostate cancer antigen". Cancer Res. 65 (10): 4097-100. doi: ... "EPCA-2" is not the name of a gene. EPCA-2 gets its name because it is the second prostate cancer marker identified by the ... April 2007). "EPCA-2: a highly specific serum marker for prostate cancer". Urology. 69 (4): 714-20. doi:10.1016/j.urology. ...
  https://en.wikipedia.org/wiki/Early_prostate_cancer_antigen-2
*  Epstein-Barr virus nuclear antigen 2 - Wikipedia
The Epstein-Barr virus nuclear antigen 2 (EBNA-2) is one of the six EBV viral nuclear proteins expressed in latently infected B ... 1993). "The Epstein-Barr Virus Nuclear Antigen 2 Interacts with an EBNA2 Responsive Cis-element of the Terminal Protein 1 Gene ... EBNA2 transactivates the promoters of the latent membrane antigens LMP, TP1 and TP2. Additionally, EBNA2 interacts with an ... 1997). "Both Epstein-Barr Viral Nuclear Antigen 2 (EBNA2) and Activated Notch1 Transactivate Genes by Interacting with the ...
  https://en.wikipedia.org/wiki/Epstein%E2%80%93Barr_virus_nuclear_antigen_2
*  Fos-related antigen 2 | definition of fos-related antigen 2 by Medical dictionary
What is fos-related antigen 2? Meaning of fos-related antigen 2 medical term. What does fos-related antigen 2 mean? ... Looking for online definition of fos-related antigen 2 in the Medical Dictionary? fos-related antigen 2 explanation free. ... redirected from fos-related antigen 2) FOSL2. A gene on chromosome 2p23.3 that encodes a leucine zipper DNA-binding FOS-type ... Fos-related antigen 2 , definition of fos-related antigen 2 by Medical dictionary https://medical-dictionary.thefreedictionary. ...
  https://medical-dictionary.thefreedictionary.com/fos-related+antigen+2
*  Bone Marrow Stromal Antigen 2 Is a Novel Plasma Biomarker and Prognosticator for Colorectal Carcinoma: A Secretome-Based...
Bone Marrow Stromal Antigen 2 Is a Novel Plasma Biomarker and Prognosticator for Colorectal Carcinoma: A Secretome-Based ... Sum-Fu Chiang, Chih-Yen Kan, Yung-Chin Hsiao, et al., "Bone Marrow Stromal Antigen 2 Is a Novel Plasma Biomarker and ... Sum-Fu Chiang,1,2 Chih-Yen Kan,3 Yung-Chin Hsiao,4 Reiping Tang,1,5 Ling-Ling Hsieh,6 Jy-Ming Chiang,1 Wen-Sy Tsai,1 Chien-Yuh ... 2Graduate Institute of Clinical Medical Sciences, College of Medicine, Chang Gung University, Taoyuan 333, Taiwan. 3Department ...
  https://www.hindawi.com/journals/dm/2015/874054/cta/
*  reagents-serology-virus-herpes-simplex-2-antigen
Antigen. Definition : Serology reagents intended to detect antigens to Herpes simplex virus serotype 2 (HSV2), a DNA virus of ... There are 2 types of basic queries: Terms and Phrases. A Term is a single word search. A Phrase would wrap a string of words in ... Home > Specialties > IVD Test Reagent/Kits, Serology, Virus, Herpes Simplex 2, Antigen ... IVD Test Reagent/Kits, Serology, Virus, Herpes Simplex 2, ... Entry Terms : "Reagents, Serology, Virus, Herpes Simplex 2, ...
  http://productguide.optometricmanagement.com/term/7338/reagents-serology-virus-herpes-simplex-2-antigen
*  The American Journal of Tropical Medicine and Hygiene | Relationship Between Humoral Response to Plasmodium falciparum...
High antibody prevalence was observed to all three antigens: the overall prevalence of IgG to FC27, 3D7, and d3D7 was 91%, 90 ... The majority of individuals ≥ 5 years of age had antibodies to both forms of MSA-2. The geometric mean antibody units increased ... This study provides the first evidence that antibodies against nonrepeat regions of MSA-2 are associated with fewer fever ... Abstract The prevalence and concentration of antibodies to merozoite surface antigen-2 (MSA-2) were measured in blood samples ...
  http://www.ajtmh.org/content/journals/10.4269/ajtmh.1994.51.593
*  Abstract 1213: Cytotoxic T lymphocyte antigen-2 alpha (CTLA-2α) induces apoptosis in lymphoma cells and is regulated by the...
Abstract 1213: Cytotoxic T lymphocyte antigen-2 alpha (CTLA-2α) induces apoptosis in lymphoma cells and is regulated by the ... Abstract 1213: Cytotoxic T lymphocyte antigen-2 alpha (CTLA-2α) induces apoptosis in lymphoma cells and is regulated by the ... Abstract 1213: Cytotoxic T lymphocyte antigen-2 alpha (CTLA-2α) induces apoptosis in lymphoma cells and is regulated by the ... Abstract 1213: Cytotoxic T lymphocyte antigen-2 alpha (CTLA-2α) induces apoptosis in lymphoma cells and is regulated by the ...
  http://cancerres.aacrjournals.org/content/70/8_Supplement/1213
*  Danish children born with glutamic acid decarboxylase-65 and islet antigen-2 autoantibodies at birth had an increased risk to...
Danish children born with glutamic acid decarboxylase-65 and islet antigen-2 autoantibodies at birth had an increased risk to ... and islet antigen-2 autoantibodies (IA-2A) at birth predict type 1 diabetes. Design and methods: The design was an individually ... and islet antigen-2 autoantibodies (IA-2A) at birth predict type 1 diabetes. Design and methods: The design was an individually ... and islet antigen-2 autoantibodies (IA-2A) at birth predict type 1 diabetes. Design and methods: The design was an individually ...
  https://lup.lub.lu.se/search/publication/1876160
*  Sperm-specific antigen 2
MDRPLSSSAEAEEELEWQVASRRRKAWAKCRSSWQASETEDLSTEATTQDEEEDEEEDLPGAQLPAAGGR 1 - 70 GNVPNEKIAIWLKDCRTPLGASLDEQSSSTLKGVLVRNGGSFEDDLSLGAEANHLHESDAQIENCNNILA 71 - 140 KERRLQFHQKGRSMNSTGSGKSSGTVSSVSELLELYEEDPEEILYNLGFGRDEPDIASKIPSRFFNSSSF 141 - 210 AKGIDIKVFLSAQMQRMEVENPNYALTSRFRQIEVLTTVANAFSSLYSQVSGTPLQRIGSMSSVTSNKET 211 - 280 DPPPPLTRSNTANRLMKTLSKLNLCVDKTEKGESSSPSPSAEKGKILNVSVIEESGNKNDQKSQKIMKKK 281 - 350 ESSSMLATVKEEVSGSSAAVTENADSDRISDEANSNFNQGTENEQSKETQSHESKLGEESGIVESKLDSD 351 - 420 FNISSHSELENSSELKSVHISTPEKEPCAPLTIPSIRNIMTQQKDSFEMEEVQSTEGEAPHVPATYQLGL 421 - 490 TKSKRDHLLRTASQHSDSSGFAEDSTDCLSLNHLQVQESLQAMGSSADSCDSETTVTSLGEDLATPTAQD 491 - 560 QPYFNESEEESLVPLQKGLEKAAAVADKRKSGSQDFPQCNTIENTGTKQSTCSPGDHIIEITEVEEDLFP 561 - 630 AETVELLREASAESDVGKSSESEFTQYTTHHILKSLASIEAKCSDMSSENTTGPPSSMDRVNTALQRAQM 631 - 700 KVCSLSNQRMGRSLLKSKDLLKQRYLFAKAGYPLRRSQSLPTTLLSPVRVVSSVNVRLSPGKETRCSPPS 701 - 770 FTYKYTPEEEQELEKRVMEHDGQSLVKSTIFISPSSVKKEEAPQSEAPRVEECHHGRTPTCSRLAPPPMS 771 - 840 ...
  https://pharos.nih.gov/idg/targets/P28290
*  Tap2 - Antigen peptide transporter 2 - Mus musculus (Mouse) - Tap2 gene & protein
Involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I ... antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent Source: MGI ,p> ... antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent Source: MGI ,p ... antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent Source: MGI ,p>Inferred from ...
  http://www.uniprot.org/uniprot/P36371
*  "Bone marrow stromal antigen 2 expressed in cancer cells promotes mamma" by Wadie D. Mahauad-Fernandez, Kris A. DeMali et al.
Bone marrow stromal antigen 2 (BST-2) is one such gene whose role in cancer is not clear. BST-2 is a unique innate immunity ... Results: BST-2 in breast tumors and mammary cancer cells is a strong predictor of tumor size, tumor aggressiveness, and host ... Thus, BST-2 may (1) serve as a biomarker for aggressive breast cancers, and (2) be a novel target for breast cancer ... In humans, BST-2 mRNA is elevated in metastatic and invasive breast tumors. In mice, orthotopic implantation of mammary tumor ...
  http://ir.uiowa.edu/microbiology_pubs/2/
*  Evalutaion of immune responses of a recombinant theileria parva 2 antigen fused with a cell penetrating peptide from human...
... to CTL target antigens from T. parva vaccine candidate antigen (Tp2) enhances the stimulation of bovine CD8+ CTL responses in ... specific CD8+ T cell responses in vitro can be achieved by antigen delivery to bovine antigen presenting cells (APC) by trans- ... An experiment was conducted in thirty mice to assess the ability of CPP-antigen fusion proteins to stimulate CTL responses in ... A number of T. parva vaccine candidate antigens have been identified that are the targets of CTL from immune cattle. ...
  https://cgspace.cgiar.org/handle/10568/79535
*  "Lymphcoyte recognition of h-2 antigen in liposomes." by S H. Herrmann and M F. Mescher
Herrmann, S H. and Mescher, M F., "Lymphcoyte recognition of h-2 antigen in liposomes." (1981). Subject Strain Bibliography ...
  https://mouseion.jax.org/ssbb1981/2242/
*  WikiGenes - MAGED2 - melanoma antigen family D, 2
Cancer/testis antigens: structural and immunobiological properties. Kirkin, A.F., Dzhandzhugazyan, K.N., Zeuthen, J. Cancer ... A novel RING-type ubiquitin ligase breast cancer-associated gene 2 correlates with outcome in invasive breast cancer. Burger, A ... In this study, we examined whether the breast cancer-associated gene 2 (BCA2), a novel RING domain protein, has E3 ubiquitin ... and breast cancer-associated gene 2 (BRCA2), the latter of which is involved in homologous recombination repair of DNA double- ...
  https://www.wikigenes.org/e/gene/e/10916.html
*  WikiGenes - MAGEE2 - melanoma antigen family E, 2
Synonyms: HCA3, Hepatocellular carcinoma-associated protein 3, MAGE-E2 antigen, Melanoma-associated antigen E2, melanoma ...
  https://www.wikigenes.org/e/gene/e/139599.html