Phospholipase A2 group IVD is a protein that in humans is encoded by the PLA2G4D gene. The phospholipase A2 enzyme family, ... "Entrez Gene: Phospholipase A2 group IVD". Retrieved 2017-09-13. Chiba, H; Michibata, H; Wakimoto, K; Seishima, M; Kawasaki, S; ... Okubo, K; Mitsui, H; Torii, H; Imai, Y (2004). "Cloning of a gene for a novel epithelium-specific cytosolic phospholipase A2, ... "Cloning of a gene for a novel epithelium-specific cytosolic phospholipase A2, cPLA2delta, induced in psoriatic skin". J. Biol. ...
Showing Protein Group XIIB secretory phospholipase A2-like protein (HMDBP00062). IdentificationBiological propertiesGene ... Rouault M, Bollinger JG, Lazdunski M, Gelb MH, Lambeau G: Novel mammalian group XII secreted phospholipase A2 lacking enzymatic ... Group XIIB secretory phospholipase A2-like protein MKLASGFLVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGK ...
... endotoxin increases group II, but not group I, phospholipase A2 mRNA expression in the glandular stomach and distal ileum, and ... The results show that (a) group II phospholipase A2 is present along the whole gastrointestinal tract, but in particularly ... Effects of endotoxin and dexamethasone on group I and II phospholipase A2 in rat ileum and stomach. ... Effects of endotoxin and dexamethasone on group I and II phospholipase A2 in rat ileum and stomach. ...
The phospholipase A2 active fractions were immunochemically characterised using specific antibody directed against human group ... Raised serum activity of phospholipase A2 immunochemically related to group II enzyme in inflammatory bowel disease: its ... Raised serum activity of phospholipase A2 immunochemically related to group II enzyme in inflammatory bowel disease: its ... II phospholipase A2 purified from rheumatoid synovial fluid. The results suggest that raised serum phospholipase A2 activity in ...
Secreted group IIA phospholipase A2 protects humans against the group B streptococcus: experimental and clinical evidence. ... Here, we analyze the role of human group IIA secreted phospholipase A2 (sPLA2-IIA), a bactericidal enzyme induced during acute ... List by Head Name List by Department Laboratories UTechS Junior Group (G5) Technological Poles Platforms Groups Collections ... Group B streptococcus (GBS) is a leading neonatal pathogen and a growing cause of invasive disease in the elderly, with ...
CRYSTAL STRUCTURE OF BEE-VENOM PHOSPHOLIPASE A2 IN A COMPLEX WITH A TRANSITION-STATE ANALOGUE ... Entity Groups Sequence Clusters. 30% Identity50% Identity70% Identity90% Identity95% Identity100% Identity. ... Crystal structure of bee-venom phospholipase A2 in a complex with a transition-state analogue.. Scott, D.L., Otwinowski, Z., ... The 2.0 angstroms crystal structure of a complex containing bee-venom phospholipase A2 (PLA2) and a phosphonate transition- ...
Overexpression Of Cytosolic Group Iva Phospholipase A2 Protects Cells From Ca2-Dependent Death. ...
Group VI Phospholipases A2 / genetics * Group VI Phospholipases A2 / metabolism* * Group X Phospholipases A2 / metabolism* ... Phospholipase PLA2G6, a Parkinsonism-Associated Gene, Affects Vps26 and Vps35, Retromer Function, and Ceramide Levels, Similar ... Phospholipases typically hydrolyze glycerol phospholipids, but loss of iPLA2-VIA does not affect the phospholipid composition ...
Group VI Phospholipases A2 / genetics * Humans * Melanoma / etiology * Melanoma / genetics* * Nevus / pathology ...
PLA2G6: phospholipase A2 group VI. *PLAGL1: PLAG1 like zinc finger 1. *PLCB4: phospholipase C beta 4 ...
PLA2G2F-phospholipase A2 group IIF; MYL7-myosin light chain 7; HS3ST4-heparan sulfate glucosamine 3-O- sulfotransferase 4; UST- ... Th1 and Th2 activity was higher in the untreated group and the ΔspaF-treated group than in the CNCM I-3690-treated group (p , ... ΔspaF-treated groups had a thinner mucus layer than the control group or the CNCM I-3690-treated group (p , 0.05). ... They were filtered (retained if more than 60% non-zeros in at least one group and mean above 0.01% in at least one group). A ...
Phospholipase A2, group IVC (cytosolic, calcium-independent). 3.92. 44.14. ENSG00000065600. TMEM206. Transmembrane protein 206 ...
Transcellular Secretion of Group V Phospholipase A2 from Epithelium Induces β2-Integrin Mediated Adhesion and Synthesis of ...
... is one of the most potent enzymes of the phospholipase A(2) lipolytic enzyme superfamily. Its high catalytic activity toward ... Secreted phospholipase A2 group X (sPLA(2)-X) is one of the most potent enzymes of the phospholipase A(2) lipolytic enzyme ... Macrophage secretory phospholipase A2 group X enhances anti-inflammatory responses, promotes lipid accumulation, and ... Macrophage secretory phospholipase A2 group X enhances anti-inflammatory responses, promotes lipid accumulation, and ...
Expression of Phospholipase A2 Group IVA (PLA2G4A) Is Upregulated by Human Chorionic Gonadotropin in Bovine Granulosa Cells of ... We hypothesized that phospholipase A2 group IVA (PLA2G4A) expression is upregulated in granulosa cells (GC) at ovulation. We ... "Expression of Phospholipase A2 Group IVA (PLA2G4A) Is Upregulated by Human Chorionic Gonadotropin in Bovine Granulosa Cells of ... "Expression of Phospholipase A2 Group IVA (PLA2G4A) Is Upregulated by Human Chorionic Gonadotropin in Bovine Granulosa Cells of ...
Phospholipase A2 (PLA(2)). Test Set for DILI modeling. Training Set for DILI modeling. ... Bull Group Burdette Group, UCONN. Caddick Group, University College London. Caddick, Sussex. Caddick/Cloke Groups, Sussex. ... Guy C. Lloyd-Jones Group, Bristol. Haddleton Group, Warwick. Harrity Group, University of Sheffield. Harrowven Group, ... Synthetic Group, Botswana. Taneisa Grier. TargetMol. Tarun K Sarkar Group, Kharagpur, India. Taylor Group, York. TCI. testing ...
phospholipase A2 group IIC. Gene Type: protein-coding Organism: Homo sapiens Chromosome: 1 NCBI GeneID: 391013 Location: ...
A V3C mutant has also been constructed to provide a potential site of chemical attachment of fluorescent reporter groups. ... Baker, Sharon Felicity (1998) Studies of the interfacial and heparin binding properties of secreted phospholipases A2. ... Studies of the interfacial and heparin binding properties of secreted phospholipases A2 ... Studies of the interfacial and heparin binding properties of secreted phospholipases A2 ...
phospholipase A2 group VII. ISO. RGD. PMID:21698055. RGD:6482785. NCBI chrNW_004955437:11,534,251...11,577,942 Ensembl chrNW_ ... prion protein (Kanno blood group). ISO. ClinVar Annotator: match by term: Fatal familial insomnia. ClinVar. OMIM. PMID:1351274 ... nuclear receptor subfamily 3 group C member 1. ISO. mRNA, protein:increased expression:lymphoid tissue:. RGD. PMID:15611350. ...
Phospholipase A2 is well known for its role in liver fibrosis and inhibition of tumour cells. The JNK signalling pathway is ... Secreted phospholipase A2 (sPLA2) is a protein secreted by Clonorchis sinensis and is a component of excretory and secretory ... Deficiency of Group IVA phospholipase A2 (IVA-PLA2) alleviates the deposition of lipids and delays the formation of liver ... Group IVA phospholipase A2 participates in the progression of hepatic fibrosis. FASEB J. 2012;26(10):4111-21. ...
1995) Dopamine D2 receptors potentiate arachidonate release via activation of cytosolic, arachidonate-specific phospholipase A2 ... SCH23390 group and p , 0.05 for the dopamine + sulpiride group, compared with dopamine group). Co-presence of SCH23390 and ... group I antagonist), or MSOPPE (group II antagonist). Thus, for this LTD induction, concurrent synaptic activation of group I ... 2A,3A, and 4A), and although 50 Hz tetani in the presence of groups I and II agonist 1S,3R-ACPD, but not group I agonist DHPG, ...
... group_III_like, PLA2_group_III_like: A sub-family of Phospholipase A2, similar to human group III PLA2 ... cd04705: PLA2_group_III_like Download alignment. PLA2_group_III_like: A sub-family of Phospholipase A2, similar to human group ... The conserved catalytic His and Asp residues are poorly conserved in this group. ...
phospholipase A2 group III * Synonyms gene name. *phospholipase A2, group III. * Synonyms ...
Platelets release mitochondria serving as substrate for bactericidal group IIA-secreted phospholipase A2 to promote ... Cardiovascular diseases refer to a group of disorders affecting the heart and blood vessels, including coronary artery disease ...
Critical role of phospholipase A2 group IID in age-related susceptibility to severe acute respiratory syndrome-CoV infection. J ... group 1 [human CoV 229E] and group 2 [human CoV OC43]). ...
Phospholipase A2 group VI (PLA2G6, iPLA2β) is a calcium-independent phospholipase that cleaves acyl tails from the glycerol ... One group has designed a nanomaterial encapsulated MON with p53 plasmid (MON-p53) [134]. When delivered into tumor cells or ...
CRYSTAL STRUCTURE OF THE COMPLEX FORMED BETWEEN PHOSPHOLIPASE A2 AND DICLOFENAC AT 2.7 A RESOLUTION: - 2B17 , canSARS ... TO PHOSPHOLIPASE A2: CRYSTAL STRUCTURE OF THE COMPLEX FORMED BETWEEN PHOSPHOLIPASE A2 AND DICLOFENAC AT 2.7 A RESOLUTION: ... TO PHOSPHOLIPASE A2: CRYSTAL STRUCTURE OF THE COMPLEX FORMED BETWEEN PHOSPHOLIPASE A2 AND DICLOFENAC AT 2.7 A RESOLUTION: ...
Book Anti Phospholipase A2 Receptor Test (PLA2R) in Jaipur with NABL-accredited Redcliffe Labs. One-stop destination for ... The anti-phospholipase-a2-receptor-pla2r measures anti-phospholipase A2 receptor levels in the blood for detecting membranous ...
Group XII secretory phospholipase A2 precursor. Phospholipase A2 domain superfamily. Phospholipase A2, histidine active site. ... phospholipase A2, group XIIA Symbol. pla2g12a Nomenclature History Previous Names. *PLA2 group XII (1) ... Orthologous to human PLA2G12A (phospholipase A2 group XIIA). Genome Resources. *Alliance (1) ... Predicted to enable phospholipase A2 activity. Predicted to act upstream of or within arachidonic acid secretion; lipid ...
Fucoidans also inhibit the enzyme phospholipase A2 (PLA-2) that turns on inflammatory processes.. These sulfated ... NaturalNews) Kelp is a group of large sea algae that is commonly referred to as seaweed. This amazing plant species has been ... Kelloggs found to have financial ties to the money man for cop-killing left-wing HATE groups: George Soros ... Sea vegetables also contain a unique group of polysaccharides called fucoidans. These fucoidans have a characteristic branching ...