GPI-Linked Proteins / antagonists & inhibitors * GPI-Linked Proteins / immunology * Humans * Immunoconjugates / pharmacology* ...
GPI-Linked Proteins * Histocompatibility Antigens Class I * Il2rg protein, mouse * Intercellular Signaling Peptides and ...
"The growth suppressing gas1 product is a GPI-linked protein". FEBS Letters. 481 (2): 152-158. doi:10.1016/s0014-5793(00)02004-4 ... "The growth suppressing gas1 product is a GPI-linked protein". FEBS Letters. 481 (2): 152-158. doi:10.1016/S0014-5793(00)02004-4 ... Growth arrest-specific protein 1 is a protein that in humans is encoded by the GAS1 gene. Growth arrest-specific 1 plays a role ... The signal emission of GAS 1 protein associate with two different types of transmembrane receptor protein, including RET and ...
The GPI-linked protein LY6A drives AAV-PHP.B transport across the blood-brain barrier. Mol. Ther. 27, 912-921 (2019). ... Anyone you share the following link with will be able to read this content:. Get shareable link. Sorry, a shareable link is not ... Precision Plus Protein All Blue Prestained Protein Standards (Bio-Rad, 1610373) ladder was used. Secondaries used were LI-COR ... Paulk, N. Gene therapy: it is time to talk about high-dose AAV: the deaths of two children with X-linked myotubular myopathy in ...
1997) A GPI-linked protein that interacts with RET to form a candidate neurturin receptor. Nature 387:717-721. ... but operates via another GPI-linked binding protein termed GFRα-2 (Baloh et al., 1997;Buj-Bello et al., 1997; GFRα Nomenclature ... 1997) Neurturin responsiveness requires a GPI-linked receptor and Ret receptor tyrosine kinase. Nature 387:721-724. ... 1997) Nomenclature of GPI linked receptors for the GDNF ligand family. Neuron 19:485. ...
2019). The GPI-linked protein LY6A drives AAV-PHP.B transport across the blood-brain barrier. Mol. Ther. 27, 912-921. doi: ... Additionally, the Rab (Ras-related proteins in the brain) GTPase protein family is specifically required for signaling endosome ... in which several viral proteins (e.g., Gag structural proteins) are removed to permit reverse transcription of the viral RNA ( ... 2016). Decreased function of survival motor neuron protein impairs endocytic pathways. Proc. Natl. Acad. Sci. U S A 113, E4377- ...
The glypicans (GPCs) are HSPGs anchored through the glycosylphosphatidylinositol (GPI) link to the outer layer of cell ... from the other members of the GAG family as it neither contains sulfate groups nor is it covalently linked into a core protein ... A. J. McFall and A. C. Rapraeger, "Identification of an adhesion site within the syndecan-4 extracellular protein domain," The ... PGs, molecules which consist of a protein core that is covalently modified with GAG chains, are distributed both to the ECM " ...
After identifying granulocytes and monocytes populations, two GPI-linked proteins are assessed on each cell population. The ... The product of the PIGA gene is required for the synthesis of anchor protein known as GPI- anchor that ties other proteins to ... Two GPI-anchored proteins (CD55&CD59) normally function as complement regulatory proteins. CD59 also called membrane inhibitor ... C: display of FLAER and CD14 as the two GPI-anchored proteins expressed on monocytes with 7.7% PNH clone lacking both proteins. ...
Ly6A/E is a glycosylphosphatidylinositol (GPI)-linked protein expressed on hematopoietic stem cells. In mice expressing the Ly- ... PubMed link indicates BioLegend citation) *Ortega G, et al. 1986. J. Immunol. 137:3240. (WB, IP) ...
This myeloid differentiation antigen is a glycosylphosphatidylinositol (GPI)-linked protein expressed on granulocytes and ... Gr-1 is a 21-25 kD protein also known as Ly-6G/Ly-6C. ... GPI)-linked protein expressed on granulocytes and macrophages. ... PubMed link indicates BioLegend citation) *Fleming TJ, et al. 1993. J. Immunol. 151:2399. (IP) ... Gr-1 is a 21-25 kD protein also known as Ly-6G/Ly-6C. This myeloid differentiation antigen is a glycosylphosphatidylinositol ( ...
... linked protein with a molecular weight of 100 kDa expressed on granulocytes. This molecule was previously clustered as CD67 in ... linked protein with a molecular weight of 100 kDa expressed on granulocytes. This molecule was previously clustered as CD67 in ... GPI) linked protein with a molecular weight of 100 kDa expressed on granulocytes. This molecule was previously clustered as ... Kuijpers TW, van der Schoot CE, Hoogerwerf M, Roos D. Cross-linking of the carcinoembryonic antigen-like glycoproteins CD66 and ...
The Rae-1 family is a group of closely related GPI-linked proteins that function as ligands for NKG2D. Binding of Rae-1 ... When tested in flow cytometry against a panel of transfectants expressing different Rae-1 proteins, this antibody recognizes ... proteins to NKG2D results in the activation of cytolytic activity and/or cytokine production by effector T cells and NK cells. ...
Description: The 61D3 monoclonal antibody reacts with human CD14, a 53-55 kDa GPI-linked glycoprotein. CD14 is expressed on ... The amount of proteins expression was quantified using densitometry and presented as bar graph. The data are presented as the ... Separated proteins were transblotted onto PVDF membrane and probed with mouse anti-CD14 antibody (Abcam) followed by secondary ... lipopolysaccharide binding opsonin receptor activity protein binding peptidoglycan receptor activity lipoteichoic acid binding ...
GPI) anchor, and as a consequence all GPI-linked proteins are not expressed on affected HSC and their mature progeny blood ... which are normally expressed on cell surface through a GPI anchor. Among all the GPI-linked proteins which are missing on PNH ... Among the missing GPI-linked proteins, the lack of the two complement inhibitors CD55 (9-11) and CD59 (12, 13) makes ... blockade recapitulates the complement protein 3 (C3) binding to GPI-negative erythrocytes observed in paroxysmal nocturnal ...
Transfers ethanolamine phosphate to the GPI third mannose which links the GPI-anchor to the C-terminus of the proteins by an ... Showing Protein GPI ethanolamine phosphate transferase 3 (HMDBP07329). IdentificationBiological propertiesGene properties ... Takeda S, Kadowaki S, Haga T, Takaesu H, Mitaku S: Identification of G protein-coupled receptor genes from the human genome ... Protein Sequence. ,GPI ethanolamine phosphate transferase 3 MQKASVLLFLAWVCFLFYAGIALFTSGFLLTRLELTNHSSCQEPPGPGSLPWGSQGKPGA ...
Useful Links. Bangalore Life Science Cluster. Contact Us. Telephone Directory. Campus Map. Shuttle Trips. Holidays. Tenders & ... Diffusion of GPI-anchored proteins is influenced by the activity of dynamic cortical actin.. Title. Diffusion of GPI-anchored ... Thus cell surface diffusion of GPI-anchored proteins and transmembrane proteins that associate with actin is driven by active ... Diffusion of GPI-anchored proteins is influenced by the activity of dynamic cortical actin.. ...
... a GPI-linked protein of the immunoglobulin superfamily; and the neurexin-like protein contacin-associated protein (Caspr; ... Identification of a novel contactin-associated transmembrane receptor with multiple domains implicated in protein-protein ... Identification of a novel contactin-associated transmembrane receptor with multiple domains implicated in protein-protein ... Proteins extracts from brain (BR), spinal cord (SC), and sciatic nerve (SN) of wild-type (WT), or Caspr null mice (KO) were ...
Most type II PNH cells (total lack of GPI-linked protein) are due to a frame shift mutation occurring in the early ... In PNH, the peripheral blood and bone marrow is a mosaic composed of GPI-AP+ and GPI-AP- cells; with GPI-AP-, cells can be ... only one mutation is required in either males or females to abolish the expression of GPI-linked proteins. ... increased plasma levels of urokinase-type plasminogen activator and platelets deficient in GPI-linked proteins activated by ...
Most type II PNH cells (total lack of GPI-linked protein) are due to a frame shift mutation occurring in the early ... In PNH, the peripheral blood and bone marrow is a mosaic composed of GPI-AP+ and GPI-AP- cells; with GPI-AP-, cells can be ... only one mutation is required in either males or females to abolish the expression of GPI-linked proteins. ... increased plasma levels of urokinase-type plasminogen activator and platelets deficient in GPI-linked proteins activated by ...
GPI-Linked Proteins [D12.776.395.550.448]. *Ephrin-A1 [D12.776.395.550.448.300]. *Intercellular Signaling Peptides and Proteins ... It is linked to the CELL MEMBRANE via a GLYCOINOSITOL PHOSPHOLIPID MEMBRANE ANCHOR and binds EPHA2 RECEPTOR with high affinity ... Login to edit your profile (add a photo, awards, links to other websites, etc.) ...
Further, TM and GPI-linked Eph ligands appear to exert repellant activity by different mechanisms, opening up the possibility ... The Amyotrophic lateral sclerosis 8 protein VAPB is cleaved, secreted, and acts as a ligand for Eph receptors. VAP proteins ( ... proteins. VAPs also interact with oxysterol-binding protein (OSBP) and ceramide transfer protein. These interactions are each ... Ephrin-As are GPI-anchored to the membrane, requiring that they complex with transmembrane proteins that transduce their ...
GPI-linked cell surface proteins that function as ligands for mouse NKG2D, an activating receptor expressed on NK and T cells. ... Rae-1 protein expression on tumor cell lines has been implicated in in vivo tumor rejection. ... The data collected includes not only links to publications in PubMed, but also provides information about sample types, species ... When tested in flow cytometry against a panel of transfectants expressing different Rae-1 proteins, this antibody strongly ...
... or GPI-linked proteins (Muniz et al., 2001). In future work, it will be important to explore not only the potential role(s) of ... GPI-linked proteins exit by yet a third unique pathway that involves their sorting into sphigolipid-rich rafts in the ER (Muniz ... C with primary antibodies and proteins captured with Protein A-tris acryl. Proteins retained on the resin after three washes ... A novel mammalian orthologue of the yeast protein Sec31p has been cloned and characterized. This protein, termed Sec31B, arises ...
Most type II PNH cells (total lack of GPI-linked protein) are due to a frame shift mutation occurring in the early ... In PNH, the peripheral blood and bone marrow is a mosaic composed of GPI-AP+ and GPI-AP- cells; with GPI-AP-, cells can be ... only one mutation is required in either males or females to abolish the expression of GPI-linked proteins. ... increased plasma levels of urokinase-type plasminogen activator and platelets deficient in GPI-linked proteins activated by ...
GPI-Linked Proteins. Hedgehog Proteins. Humans. Inflammation. Male. Mice. 129 Strain. Mice ...
Lipid-Linked Proteins * GPI-Linked Proteins [D12.776.543.484.500] GPI-Linked Proteins ... A GPI-linked membrane glycoprotein and antiviral factor that functions as a homodimer. It is induced by INTERFERON-GAMMA and ... A GPI-linked membrane glycoprotein and antiviral factor that functions as a homodimer. It is induced by INTERFERON-GAMMA and ... Glucoproteína de membrana unida a GPI y factor antiviral que funciona como homodímero. Es inducida por el INTERFERÓN GAMMA y ...
Lipid-Linked Proteins [D12.776.543.484]. *GPI-Linked Proteins [D12.776.543.484.500]. *Carbonic Anhydrase IV [D12.776.543.484. ...
Caveolins can serve as protein markers of caveolae (little caves), invaginations in the plasma membrane 50-100 nanometers in ... has greater protein-sequence similarity to Cav-1 than to Cav-2, but it is expressed mainly in muscle cells, including smooth, ... but the proteins have also been found in other animals, including Xenopus laevis, Fugu rubripes, and Caenorhabditis elegans. ... A description of the method for purifying caveolae and GPI-linked sorting in epithelial cells. ...
Uromodulin is a glycosyl phosphatidylinositol (GPI) linked glycoprotein exclusively synthesized in renal tubular epithelial ... Tamm-Horsfall protein-deficient thick ascending limbs promote injury to neighboring S3 segments in an MIP-2-dependent mechanism ... Anyone you share the following link with will be able to read this content:. Get shareable link. Sorry, a shareable link is not ... Uromodulin is the most abundant protein in urine [7,8,9] and is specifically synthesized and secreted by kidney tubular ...