No data available that match "Chemical Actions and Uses"



*  Care2: Given the recent evidence of chemical weapons use by the Syrian government, should the US take military action?

Given the recent evidence of chemical weapons use by the Syrian government, should the US take military action?. (CLOSED) ...
care2.com/polls/vote?pollID=35166

*  New Descriptors by Tree Subcategory - 2015

D27 (Chemical Actions and Uses). Acetaldehyde Dehydrogenase Inhibitors. Acetylcholine Release Inhibitors. Amylin Receptor ... G2 (Chemical Phenomena). Absorption, Physicochemical. Absorption, Radiation. Drug Liberation. Protein Aggregation, Pathological ...
https://nlm.nih.gov/mesh/newbysub.html

*  RCSB PDB - Ligand Summary Page

Antivirals for Systemic Use. *Central Nervous System Depressants. *Chemical Actions and Uses ... Searches the Chemical Structure Lookup Service (CSLS), meant to work as an address book for chemical structures ... For use in combination treatment of HIV infection (AIDS) Pharmacology. Efavirenz (dideoxyinosine, ddI) is an oral non- ... Dictionary of chemical components in the PDB. PubChem Searches PubChem, a component of NIH's Molecular Libraries Roadmap ...
rcsb.org/pdb/ligand/ligandsummary.do?handler=biologyChemistry&hetId=EFZ

*  RCSB PDB - Ligand Summary Page

Chemical Actions and Uses. *Combined Inhibitors of CYP3A4 and P-glycoprotein. *Cytochrome P-450 CYP3A Inhibitors ... Pharmacological Action. Actions. Peptidyl-prolyl cis-trans isomerase FKBP1A MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFM ... Searches the Chemical Structure Lookup Service (CSLS), meant to work as an address book for chemical structures ... Dictionary of chemical components in the PDB. PubChem Searches PubChem, a component of NIH's Molecular Libraries Roadmap ...
rcsb.org/pdb/ligand/ligandsummary.do?handler=biologyChemistry&hetId=RAP

*  Effects of Different Exercise Modes on the Urinary Metabolic Fingerprint of Men with and without Metabolic Syndrome.

Chemical Actions And Uses. A group of pharmacologic activities, effects on living systems and the environment, and modes of ... employment of drugs and chemicals. They are broken into actions, which describe their effects, and uses, which describe how ... "Fair Use" and legitimately infringes on your or your client's copyright we may be contacted concerning copyright matters at: ...
bioportfolio.com/resources/pmarticle/1665343/Effects-of-Different-Exercise-Modes-on-the-Urinary-Metabolic-Fingerprint-of-Men.html

*  RCSB - Ligand Summary Page

Chemical Actions and Uses. *Combined Inhibitors of CYP3A4 and P-glycoprotein. *Cytochrome P-450 CYP2B6 Inducers ... Mechanism of action. The effects of testosterone in humans and other vertebrates occur by way of two main mechanisms: by ... Use in males: For management of congenital or acquired hypogonadism, hypogonadism associated with HIV infection, and male ... climacteric (andopause). Use in females: For palliative treatment of androgen-responsive, advanced, inoperable, metastatis ( ...
www4.rcsb.org/ligand/TES

*  https://www.thefreelibrary.com/Computational+model+of+steroidogenesis+in+human+H295R+cells+to...-a0219521665

Computational model of steroidogenesis in human H295R cells to predict biochemical response to endocrine-active chemicals: ... Endocrine-disrupting chemicals use distinct mechanisms of action to modulate endocrine system function. Endocrinology 147(suppl ... This capability could be useful to help define mechanisms of action for poorly characterized chemicals and mixtures in support ... steroidogenesis assays by helping to define mechanisms of action for poorly characterized chemicals and mixtures of chemicals ...
https://thefreelibrary.com/Computational model of steroidogenesis in human H295R cells to...-a0219521665

*  Gordon State College

Chemical Actions and Uses (89) * Biomedical materials (88) * More options Suggested New Searches. Ignore my query and look for ...
galileo-usg-gordon-primo.hosted.exlibrisgroup.com/primo_library/libweb/action/search.do

*  Albany State University - biomedical AND engineering NOT nuclear

Chemical Actions and Uses (93) * Biomedical materials (93) * More options Suggested New Searches. Ignore my query and look for ... New York : Macmillan USA ©1995. Available at Harold B. Wetherbee Library 1st Floor Reference (non-circ) (Q173 .B25 1995 Ref. ) ...
galileo-usg-asu-primo.hosted.exlibrisgroup.com/primo_library/libweb/action/search.do?srt=date2&srtChange=true&frbg=&fn=search&indx=1&dscnt=0&vl

*  JoVE | Peer Reviewed Scientific Video Journal - Methods and Protocols

... chemical and physical research. Watch our scientific video articles. ... Chemical Actions and Uses, Diagnosis, Therapeutics, Surface stress, vancomycin, mucopeptides, cantilever sensor ... We use abstracts found on PubMed and match them to JoVE videos to create a list of 10 to 30 related methods videos. ... The supplemental use of portable devices, such as PDA or smart-phones, allows the patient to perform at home, individually and ...
https://jove.com/visualize/abstract/22163303/dendrimer-based-fluorescent-indicators-vitro-vivo

*  JoVE | Peer Reviewed Scientific Video Journal - Methods and Protocols

... chemical and physical research. Watch our scientific video articles. ... Chemical Actions and Uses, Life Sciences (General), Behavioral Sciences, Arthropod behavior, chemical ecology, olfactometer, ... The use of WGA allows for several rounds of re-amplification, resulting in high quantities of DNA that can be utilized for ... We use abstracts found on PubMed and match them to JoVE videos to create a list of 10 to 30 related methods videos. ...
https://jove.com/visualize/abstract/24587059/development-assessment-plant-based-synthetic-odor-baits-for

*  JoVE | Peer Reviewed Scientific Video Journal - Methods and Protocols

... chemical and physical research. Watch our scientific video articles. ... Chemical Actions and Uses, Diagnosis, Therapeutics, Surface stress, vancomycin, mucopeptides, cantilever sensor ... We use abstracts found on PubMed and match them to JoVE videos to create a list of 10 to 30 related methods videos. ... The use of neuroimaging and morph stimuli to represent the DHL in order to disentangle brain regions neurally responsive to ...
https://jove.com/visualize/abstract/23185536/differential-deactivation-during-mentalizing-classification-autism

*  JoVE | Peer Reviewed Scientific Video Journal - Methods and Protocols

... chemical and physical research. Watch our scientific video articles. ... Chemical Actions and Uses, Diagnosis, Therapeutics, Surface stress, vancomycin, mucopeptides, cantilever sensor ... We use a cysteine-containing oligopeptide, Ala3CysNH2 (A3CH), as the model compound. The measurements are based on the well- ... We use abstracts found on PubMed and match them to JoVE videos to create a list of 10 to 30 related methods videos. ...
https://jove.com/visualize/abstract/23071722/analysis-organic-hydroperoxide-response-chromobacterium-violaceum

*  JoVE | Peer Reviewed Scientific Video Journal - Methods and Protocols

... chemical and physical research. Watch our scientific video articles. ... Chemical Actions and Uses, Enzymes, Coenzymes, Life Sciences (General), Dps, DNA protection, ferroxidase, oxidative damage, ... Here, we make use of the outstanding sensitivity of atomic absorption spectrophotometry (AAS) towards trace amounts of chemical ... One infrared assay uses the DRAQ5 stain for nuclei combined with the Sapphire stain for cytosol and is visualized in the 700 nm ...
https://jove.com/visualize/abstract/24194906/resveratrol-protects-mouse-oocytes-from-methylglyoxal-induced

*  JoVE | Peer Reviewed Scientific Video Journal - Methods and Protocols

... chemical and physical research. Watch our scientific video articles. ... Chemical Actions and Uses, Diagnosis, Therapeutics, Surface stress, vancomycin, mucopeptides, cantilever sensor ... A Microplate Assay to Assess Chemical Effects on RBL-2H3 Mast Cell Degranulation: Effects of Triclosan without Use of an ... This allows for high-resolution imaging, and importantly, avoids the use of anesthetics and chemicals, which facilitates the ...
https://jove.com/visualize/abstract/24949733/reusable-mediator-free-cholesterol-biosensor-based-on-cholesterol

*  JoVE | Peer Reviewed Scientific Video Journal - Methods and Protocols

... chemical and physical research. Watch our scientific video articles. ... Chemical Actions and Uses, Diagnosis, Therapeutics, Surface stress, vancomycin, mucopeptides, cantilever sensor ... Here, we make use of the outstanding sensitivity of atomic absorption spectrophotometry (AAS) towards trace amounts of chemical ... A Microplate Assay to Assess Chemical Effects on RBL-2H3 Mast Cell Degranulation: Effects of Triclosan without Use of an ...
https://jove.com/visualize/abstract/24586340/alanine-glyoxylate-aminotransferase-2-agxt2-polymorphisms-have

*  JoVE | Peer Reviewed Scientific Video Journal - Methods and Protocols

... chemical and physical research. Watch our scientific video articles. ... Chemical Actions and Uses, Life Sciences (General), Behavioral Sciences, Arthropod behavior, chemical ecology, olfactometer, ... requires the use of whiteflies for virus transmission. The use of whitefly transmission of plant viruses for the selection and ... We use full metabolic labeling of Arabidopsis thaliana suspension cell cultures with K15NO3 as the only nitrogen source for ...
https://jove.com/visualize/abstract/21901154/odour-maps-brain-butterflies-with-divergent-host-plant

*  JoVE | Peer Reviewed Scientific Video Journal - Methods and Protocols

... chemical and physical research. Watch our scientific video articles. ... Chemical Actions and Uses, Enzymes, Coenzymes, Life Sciences (General), Dps, DNA protection, ferroxidase, oxidative damage, ... A Microplate Assay to Assess Chemical Effects on RBL-2H3 Mast Cell Degranulation: Effects of Triclosan without Use of an ... This method uses restriction enzyme based cloning to insert the gag gene into a common subtype C HIV-1 proviral backbone, MJ4. ...
https://jove.com/visualize/abstract/25333633/theobromine-inhibits-uric-acid-crystallization-potential-application

*  JoVE | Peer Reviewed Scientific Video Journal - Methods and Protocols

... chemical and physical research. Watch our scientific video articles. ... Chemical Actions and Uses, Diagnosis, Therapeutics, Surface stress, vancomycin, mucopeptides, cantilever sensor ... but cannot be used to unambiguously assign lipid A chemical structures without the use of standards of known chemical structure ... Here, we make use of the outstanding sensitivity of atomic absorption spectrophotometry (AAS) towards trace amounts of chemical ...
https://jove.com/visualize/abstract/21858024/permeation-through-cell-membrane-boron-based-lactamase

*  JoVE | Peer Reviewed Scientific Video Journal - Methods and Protocols

... chemical and physical research. Watch our scientific video articles. ... Chemical Actions and Uses, Diagnosis, Therapeutics, Surface stress, vancomycin, mucopeptides, cantilever sensor ... the use of human tissue, and/or the use of expensive chemicals. It also provides a way to investigate the properties of each ... Here, we make use of the outstanding sensitivity of atomic absorption spectrophotometry (AAS) towards trace amounts of chemical ...
https://jove.com/visualize/abstract/21858172/probing-interaction-diarylquinoline-tmc207-with-its-target

*  JoVE | Peer Reviewed Scientific Video Journal - Methods and Protocols

... chemical and physical research. Watch our scientific video articles. ... Chemical Actions and Uses, Life Sciences (General), Behavioral Sciences, Arthropod behavior, chemical ecology, olfactometer, ... requires the use of whiteflies for virus transmission. The use of whitefly transmission of plant viruses for the selection and ... We use abstracts found on PubMed and match them to JoVE videos to create a list of 10 to 30 related methods videos. ...
https://jove.com/visualize/abstract/23700450/glutathione-s-transferase-brown-planthoppers-nilaparvata-lugens-is

*  JoVE | Peer Reviewed Scientific Video Journal - Methods and Protocols

... chemical and physical research. Watch our scientific video articles. ... Chemical Actions and Uses, Diagnosis, Therapeutics, Surface stress, vancomycin, mucopeptides, cantilever sensor ... but cannot be used to unambiguously assign lipid A chemical structures without the use of standards of known chemical structure ... This method uses restriction enzyme based cloning to insert the gag gene into a common subtype C HIV-1 proviral backbone, MJ4. ...
https://jove.com/visualize/abstract/21655293/bacterial-surface-appendages-strongly-impact-nanomechanical

*  JoVE | Peer Reviewed Scientific Video Journal - Methods and Protocols

... chemical and physical research. Watch our scientific video articles. ... Chemical Actions and Uses, Life Sciences (General), Behavioral Sciences, Arthropod behavior, chemical ecology, olfactometer, ... Summer water use in urban areas can be 2-3x winter base line water use due to increased demand for landscape irrigation. ... We argued that it is a basic requirement to integrate land use plans in urban and non-urban planning areas for land use ...
https://jove.com/visualize/abstract/25915897/influences-different-land-use-spatial-control-schemes-on-farmland

*  JoVE | Peer Reviewed Scientific Video Journal - Methods and Protocols

... chemical and physical research. Watch our scientific video articles. ... Chemical Actions and Uses, Life Sciences (General), Behavioral Sciences, Arthropod behavior, chemical ecology, olfactometer, ... requires the use of whiteflies for virus transmission. The use of whitefly transmission of plant viruses for the selection and ... The use of a synthetic probe in this approach allows photostable, red-shifted, and highly emissive organic dyes to be used for ...
https://jove.com/visualize/abstract/23226548/engineered-repressible-lethality-for-controlling-pink-bollworm

*  JoVE | Peer Reviewed Scientific Video Journal - Methods and Protocols

... chemical and physical research. Watch our scientific video articles. ... Chemical Actions and Uses, Diagnosis, Therapeutics, Surface stress, vancomycin, mucopeptides, cantilever sensor ... Furthermore, the successful completion of procedures using this technique requires the use of a laser, thus limiting its use. A ... We use abstracts found on PubMed and match them to JoVE videos to create a list of 10 to 30 related methods videos. ...
https://jove.com/visualize/abstract/19774085/an-integrated-approach-to-rapid-diagnosis-tuberculosis-multidrug

No data available that match "Chemical Actions and Uses"