• Adocia: résultats d'étude sur BioChaperone Glucagon. (combourse.com)
  • Adocia annonce les résultats principaux d'une étude clinique de Phase 1 de BioChaperone Glucagon, sa formulation aqueuse de glucagon humain, visant à en évaluer la sûreté et l. (combourse.com)
  • LYON, France--(BUSINESS WIRE)--Regulatory News : Adocia (Paris:ADOC) (Euronext Paris : FR0011184241 - ADOC), société biopharmaceutique spécialisée dans le traitement du diabète avec des formulations innovantes de protéines approuvées, annonce aujourd'hui l'initiation d'une étude clinique de Phase 1 de BioChaperone® Glucagon, sa formulation aqueuse de glucagon humain. (combourse.com)
  • Le glucagon a aussi des effets cérébraux : augmente la satiété, augmente la dépense énergétique, et paradoxalement la perfusion de glucagon dans l'hypothalamus ventro-médian inhibe la production de glucose par le foie. (wikipedia.org)
  • Le glucagon a un effet hyperglycémiant parce qu'il augmente la transformation du glycogène en glucose et inhibe parallèlement la synthèse du glycogène à partir du glucose. (pharmacorama.com)
  • Par contre, l'indométhacine (50 µg/ml) et la Des-Arg9 Leu-0-Me8-BK potentient significativement la réponse au glucagon alors que la sécrétine (10 µg/ml) inhibe significativement l'effet relaxant du glucagon sur l'artère rénale de lapin. (usherbrooke.ca)
  • Des antagonistes du glucagon sont en cours d'étude. (pharmacorama.com)
  • De plus, l'action du glucagon n'est pas affectée par des antagonistes tels propranolol (5 µg/ml), cimétidine (10 µg/ml), diphenhydramine (10 µg/ml), indométhacine (5 µg/ml), phentolamine (1.25 µg/ml), atropine (10 µg/ml), 8-leu-ATii (1 µg/ml) et par des peptides tels neurotensine (10 µg/ml), somatostatine (10 µg/ml) et insuline (10 µg/ml). (usherbrooke.ca)
  • Le glucagon est formé d'une seule chaîne de 29 acides aminés. (pharmacorama.com)
  • Indométacine : peut diminuer l'effet du glucagon. (urgences-serveur.fr)
  • Warfarine : le glucagon peut augmenter l'effet de la warfarine. (urgences-serveur.fr)
  • L'effet relaxant du glucagon sur des artères rénales de lapin est donc proposé comme un nouvel essai biologique simple, sensible et spécifique pour des études de structure-activité et des dosages éventuels du glucagon dans des extraits biologiques. (usherbrooke.ca)
  • L'action du glucagon tend à ramener la glycémie vers sa valeur physiologique en utilisant ses propriétés hyperglycémiantes. (wikipedia.org)
  • L'action relaxante du glucagon est stable, reproductible et dosedépendante à des concentrations variant entre 25 et 425 ng/ml. (usherbrooke.ca)
  • Ceci suggère que l'action du glucagon est médiée par l'AMPC. (usherbrooke.ca)
  • La technologie propriétaire BioChaperone® permet la solubilisation et la stabilisation du glucagon humain à pH neutre. (combourse.com)
  • Le peptide-2 de type glucagon ou glucagon-like peptide-2 ( GLP-2 ) est un peptide de 33 acides aminés, dont la séquence est chez l'homme HADGSFSDEMNTILDNLAARDFINWLIQTKITD (voir Acide aminé protéinogène). (wikipedia.org)
  • Le GLP-2 est créé par clivage protéolytique post-traductionnel spécifique du proglucagon dans un processus qui libère également le glucagon-like peptide-1 (GLP-1). (wikipedia.org)
  • Le glucagon-like peptide-1 ( GLP-1 ) est une incrétine , c'est-à-dire une hormone intestinale , sécrétée par les cellules entéro-endocrines de l'estomac en réponse à un repas [ 1 ] . (wikipedia.org)
  • Le GLP-1 ou glucagon-like peptide-1 est un polypeptide d'origine digestive, constitué de 30 amino-acides, dont le principal effet est de stimuler la sécrétion d'insuline et de réduire la sécrétion de glucagon. (pharmacorama.com)
  • Contrairement à l'insuline, plusieurs molécules endogènes, le glucagon, les catécholamines par leur effet ß et l'amyline, ont un effet hyperglycémiant. (pharmacorama.com)
  • La régulation de la glycémie, compte tenu de l'apport alimentaire discontinu et des besoins variables de l'organisme, nécessite des mécanismes de régulation complexes et le glucagon y participe en ayant des effets opposés à ceux de l'insuline. (pharmacorama.com)
  • Le glucagon est une hormone polypeptidique hyperglycémiante, sécrétée par les cellules a du pancréas et des cellules intestinales, qui a été découverte peu de temps après l'insuline. (pharmacorama.com)
  • Le glucagon est indiqué essentiellement dans le traitement des hypoglycémies dues à l'insuline. (pharmacorama.com)
  • Certains facteurs influencent le flux potassique : Font rentrer les ions K+ dans la cellule (effet hypokaliémiant) : les bêta-mimétiques l'adrénaline l'insuline l'alcalose Font sortir les ions K+ de la cellule (effet hyperkaliémiant) : les bêta-bloquants le glucagon l'hyperglycémie l'acidose Toute lyse cellulaire importante Le rein reste l'organe majeur de la régulation de la kaliémie. (wikipedia.org)
  • Le glucagon a un effet relaxant et peut être utilisé pour faciliter les examens radiologiques du tube digestif avec produits de contraste ainsi que les endoscopies. (pharmacorama.com)
  • Le glucagon est une hormone hyperglycémiante (qui provoque une augmentation de la quantité de glucose dans le sang) sécrétée par les cellules alpha des îlots de Langerhans du pancréas, et qui agit principalement sur le foie en provoquant une glycogénolyse. (wikipedia.org)
  • Suite à une série de recherches sur diverses préparations de muscles lisses, nous avons observé que le glucagon provoque la relaxation de l'artère rénale isolée de lapin partiellement contractée par la noradrénaline. (usherbrooke.ca)
  • Le glucagon et l'adrénaline favorisent l'hydrolyse des triglycérides en libérant du glycérol et des acides gras. (wikipedia.org)
  • Le glucagon semble avoir un rôle important dans le métabolisme des acides aminés : il favorise l'élimination des déchets azotés de la néoglucogenèse à partir des acides aminés, en activant le cycle de l'urée puis la clairance rénale de l'urée par augmentation du débit de filtration glomérulaire. (wikipedia.org)
  • De fait, les acides aminés semblent avoir un rôle majeur dans la régulation de la sécrétion du glucagon. (wikipedia.org)
  • D'autres propriétés du glucagon sont en cours de caractérisation. (wikipedia.org)
  • Le glucagon stimule les récepteurs spécifiques liés par les protéines Gs à l'adénylcyclase qui est activée, ce qui entraîne une augmentation de l'AMP cyclique, responsable de ses effets pharmacologiques. (pharmacorama.com)
  • Le glucagon a des effets indésirables : nausées, vomissements, hypoglycémie réactionnelle après la phase d'hyperglycémie, libération de catécholamines, rarement hypokaliémie. (pharmacorama.com)
  • Le glucagon a pour cible les cellules hépatiques (surtout), les adipocytes et les cellules musculaires. (wikipedia.org)
  • Du point de vue physiologique, le glucagon est une hormone et, du point de vue chimique, c'est un polypeptide. (wikipedia.org)
  • Le glucagon a un effet inotrope positif et il augmente le débit cardiaque. (pharmacorama.com)
  • Une brève étude de relation entre la structure et l'activité du glucagon démontre que la perte de l'histidine en N-terminal réduit de 89% l'activité biologique du glucagon. (usherbrooke.ca)
  • Chez les personnes ayant un pancréas pleinement fonctionnel, l'insuline et le glucagon travaillent en tandem pour maintenir la glycémie stable. (beyondtype1.org)
  • Utilisation : Le Somatostatin règle l'insuline et le glucagon, et règle le système endocrinien et affecte la neurotransmission et la prolifération cellulaire. (closebrothers.fr)
  • Le Somatostatin règle l'insuline et le glucagon. (closebrothers.fr)
  • Le pancréas sécrète principalement l'insuline et le glucagon au niveau des îlots de Langerhans. (espace-musculation.com)
  • Ces îlots fabriquent et libèrent l'insuline et le glucagon dans le sang. (cancer.ca)
  • Des recherches sur l'administration du glucagon par voie intranasale sans aiguille pourrait mettre fin à l'injection intramusculaire chez le diabétique de type 1. (sante-sur-le-net.com)
  • Cette situation nécessite l'injection de glucagon par voie intramusculaire en urgence. (sante-sur-le-net.com)
  • L'injection de glucagon entraîne immédiatement une hyper-insulinosécrétion et, secondairement, une glycogénolyse avec hyperglycémie. (commentguerir.com)
  • L'injection de glucagon est le traitement de choix des hypoglycémies chez le diabétique traite par l'insuline, lorsqu'il n'est pas en mesure d'avaler du sucre (perte de connaissance, ou malaise sévère avec impossibilité d'avaler). (vivreavecundiabete.com)
  • Ces résultats peuvent s'expliquer par le fait que le glucagon injectable n'est pas prêt à l'emploi et doit être reconstitué avec plusieurs étapes avant d'être prêt pour l'injection, pouvant créer une limite à sa bonne utilisation. (type1better.com)
  • Les résultats précliniques prometteurs obtenus chez les cochons ont montré que le profil pharmacodynamique de BioChaperone ® Human Glucagon était similaire à celui observé avec le glucagon recombinant humain commercial (Glucagen ® , Novo Nordisk, reconstitué ex temporane juste avant l'injection). (adocia.com)
  • Au total, et selon les études réalisées, ce geste est estimé à 15 secondes, et reste aussi efficace que l'injection de Glucagon. (actusantemag.com)
  • La pratique d'activité physique après l'injection du glucagon a eu le moins d'incidence sur la glycémie de départ durant et après l'activité comparativement au contrôle, à la réduction de l'insuline basale et à la consommation de glucides. (type1better.com)
  • Depuis fin septembre 2019, un nouveau mode de traitement de l'hypoglycémie sévère est approuvé par Santé Canada: le glucagon nasal BAQSIMI MC . (type1better.com)
  • Depuis août 2019, le glucagon nasal BAQSIMI est également disponible aux États-Unis pour le traitement des patients âgés de 4 ans et plus. (beyondtype1.org)
  • Si vous êtes inconscient, une autre personne devra vous injecter le glucagon dans le muscle ou vous administrer BAQSIMI dans la narine. (beyondtype1.org)
  • Quand elle n'est pas utilisée (par exemple quand elle est encore sous forme de poudre), le kit de glucagon ou l'inhalateur BAQSIMI doit être conservé à température ambiante. (beyondtype1.org)
  • Après la FDA américaine (Food and Drug Administration), l'Agence Européenne a autorisé au cours de l'année 2019 le Baqsimi 3mg, forme galénique de glucagon en spray. (actusantemag.com)
  • Après de nombreux essais infructueux d'autres formes de glucagon nasal, Baqsimi représente un progrès majeur pour les patients, leur entourage et les soignants. (actusantemag.com)
  • L'agence américaine des produits alimentaires et médicamenteux ( FDA ) a approuvé le premier produit à base de glucagon (Baqsimi ) administré par voie nasale pour le traitement de l'hypoglycémie sévère chez les patients âgés de 4 ans et plus souffrant de diabète. (santedesdiabetiques.com)
  • Baqsimi est le premier et le seul glucagon administré par voie nasale . (santedesdiabetiques.com)
  • Le glucagon est une substance hyperglycémiante qui mobilise le glycogène hépatique, celui-ci étant alors libéré dans le sang sous forme de glucose. (doctissimo.fr)
  • Le glucagon sécrété agit sur les cellules hépatiques en stimulant la libération du glucose en réserve dans le foie sous forme de glycogène. (larousse.fr)
  • Le glucagon est indiqué chez le patient diabétique en cas d'hypoglycémie (chute du glucose sanguin) due à un surdosage en insuline ayant entraîné un malaise ou un coma. (larousse.fr)
  • Le glucagon a un effet hyperglycémiant parce qu'il augmente la transformation du glycogène en glucose et inhibe parallèlement la synthèse du glycogène à partir du glucose. (pharmacorama.com)
  • Le temps médian pour atteindre un niveau cliniquement sans risque de glucose de 70 mg/dL était de 11 min pour BioChaperone Glucagon et près de 7 min pour le produit commercial reconstitué Glucagen. (capital.fr)
  • L'activation du r cepteur du glucagon humain (GCGR) par son ligand glucagon endog ne d clenche la lib ration de glucose du foie durant le je ne, et est donc une cible m dicamenteuse potentielle pour le type 2 diab tes. (lelezard.com)
  • Glucagon produit manufacturé qui peut être administré pour augmenter le taux de glucose dans le sang. (gov.on.ca)
  • Dans cette étude de BioChaperone Glucagon, des personnes avec un diabète de type 1 ont reçu une infusion d'insuline intraveineuse sous surveillance médicale pour induire un niveau de glucose plasmatique compris entre 56 et 60 mg/dL (état hypoglycémique). (mypharma-editions.com)
  • Une fois injecté, le glucagon augmente la glycémie en envoyant un signal aux muscles et au foie (où le glucose est stocké dans votre corps). (beyondtype1.org)
  • L'insuline fait baisser la glycémie, tandis que son partenaire, le glucagon, libère les réserves de glucose de l'organisme à partir du foie pour la faire augmenter. (beyondtype1.org)
  • En cas d' hypoglycémie (faible taux de sucre dans le sang), le glucagon permet à l'organisme de libérer du sucre dans la circulation sanguine, permettant aux taux de glucose de s'élever à un niveau plus sûr. (beyondtype1.org)
  • Le principal facteur de régulation des taux de glucagon dans le sang est le taux de glucose. (amelioretasante.com)
  • En raison de cette propriété, comme nous le verrons plus loin, le glucagon est largement utilisé chez les patients souffrant d'hypoglycémie , c'est-à-dire une baisse du taux de glucose. (amelioretasante.com)
  • L expression des R-glu est favorisée par le glucose et inhibée par le glucagon ainsi que les agents qui augmentent le taux d AMPc intracellulaire. (docplayer.fr)
  • Le glucagon à l'effet inverse en élevant le taux du glucose sanguin. (espace-musculation.com)
  • Si la personne est diabétique sous insuline et dans le coma, il va lui faire une injection de glucagon et lui injecter du glucose en intraveineux. (docteurclic.com)
  • 2 Les analogues du GLP-1 (Glucagon-like peptide-1) et les inhibiteurs du SGLT-2 (cotransporteur sodium/glucose de type 2) présentent un intérêt particulier en ce sens, avec leur impact sur le poids, permettant d'éviter cette spirale infernale prise pondérale-augmentation de la résistance à l'insuline. (revmed.ch)
  • Dans tous les groupes, l'effet indésirable le plus fréquent était la nausée, avec 8 événements observés chez 25 patients avec BioChaperone Glucagon contre 5 événements chez 24 patients avec Glucagen Hypokit. (capital.fr)
  • Deux produits à base de glucagon humain (GlucaGen®, Novo Nordisk et Glucagon, Eli Lilly) sont autorisés pour le traitement de l'hypoglycémie sévère. (mypharma-editions.com)
  • L'objectif principal de cette étude était d'évaluer la sûreté et la tolérabilité de doses fixes sous-cutanées de BioChaperone Glucagon et GlucaGen® HypoKit® (Novo Nordisk, poudre lyophilisée à reconstituer immédiatement avant injection) chez des sujets avec un diabète de type 1. (mypharma-editions.com)
  • Les objectifs secondaires incluaient la comparaison des profils pharmacocinétiques et pharmacodynamiques de BioChaperone Glucagon à ceux de GlucaGen HypoKit. (mypharma-editions.com)
  • En outre, l'utilisation du glucagon pour prévenir, plutôt que pour traiter, un épisode d'hypoglycémie est l'approche préconisée actuellement dans certaines versions de pancréas artificiels qui ne sont pas encore approuvées par Santé Canada. (type1better.com)
  • ADOCIA : le BioChaperone Glucagon présente un prof. (capital.fr)
  • Adocia: résultats d'étude sur BioChaperone Glucagon. (combourse.com)
  • Sur la base de ces recherches prometteuses et de sa formulation BioChaperone Glucagon, Adocia a développé BioChaperone Glucagon GLP-1, une combinaison deux-en-un de glucagon humain et d'exenatide (Byetta®, AstraZeneca), un agoniste du récepteur au GLP-1. (adocia.com)
  • En utilisant la technologie propriétaire BioChaperone ® , Adocia a pour but de développer une solution aqueuse stable de glucagon recombinant humain. (adocia.com)
  • En juin 2016, Adocia a annoncé les premiers résultats précliniques positifs pour BioChaperone ® Human Glucagon , une solution aqueuse de glucagon recombinant humain à pH physiologique. (adocia.com)
  • La technologie BioChaperone offre des propriétés uniques de solubilisation et de stabilisation du glucagon humain en solution aqueuse pure à pH physiologique, excluant tout recours à des solvants organiques ou à une mutation de la séquence d'acides aminés du peptide. (mypharma-editions.com)
  • BioChaperone Glucagon est un ajout important à notre portefeuille et est un exemple caractéristique de la pertinence croissante de notre technologie dans le traitement du diabète. (mypharma-editions.com)
  • Au vu de nos résultats précliniques prometteurs, nous avons établi un plan de développement visant à tester BioChaperone Glucagon dans une étude clinique au premier semestre de 2017 », souligne Olivier Soula, Directeur général délégué et Directeur R&D. (mypharma-editions.com)
  • La technologie propriétaire BioChaperone® permet la solubilisation et la stabilisation du glucagon humain à pH neutre. (combourse.com)
  • Nous sommes très heureux de rapporter les résultats principaux positifs de la première étude clinique de BioChaperone Glucagon, la seule formulation aqueuse stable de glucagon humain en développement. (mypharma-editions.com)
  • Olivier Soula, Directeur Général Délégué et Directeur de la R&D, ajoute : « BioChaperone Glucagon montre que la technologie de formulation BioChaperone permet d'obtenir des produits prêts à injecter à partir de protéines instables qui nécessitaient d'être lyophilisées, tout en maintenant leur efficacité clinique. (mypharma-editions.com)
  • BioChaperone Glucagon GLP-1 pour le traitement de l'obésité a pour but de proposer un traitement multi-hormonal performant et facile à utiliser. (adocia.com)
  • BioChaperone Glucagon GLP-1 est actuellement en phase de développement préclinique, avec pour objectif de débuter le premier essai clinique chez l'homme en 2020. (adocia.com)
  • L'étude documentera la sécurité et la tolérance de BioChaperone Glucagon ainsi que ses profils pharmacocinétique et pharmacodynamique chez des personnes avec un diabète de type 1. (adocia.com)
  • Toutefois, ces kits d'urgence nécessitent, avant injection, la dissolution d'un lyophilisat de glucagon dans de l'eau stérile à cause de l'instabilité du glucagon humain dans l'eau. (mypharma-editions.com)
  • Cette stratégie de formulation, qui s'appuie sur l'historique d'efficacité et de sécurité du glucagon humain, pourrait significativement écourter le plan de développement clinique en comparaison avec celui d'un nouvel analogue du glucagon », poursuit-elle. (mypharma-editions.com)
  • Un flacon de verre muni d'un bouchon contient 1 mg de glucagon, correspondant à 1 mg de glucagon/mL après reconstitution. (santecheznous.com)
  • Par ailleurs, d'autres études ont démontré que le glucagon nasal est aussi efficace que le glucagon injectable pour faire remonter la glycémie chez l'adulte, chez les enfants et même en présence d'un rhume puisqu'il n'est pas nécessaire d'inhaler la poudre. (type1better.com)
  • un pancréas artificiel bi-hormonal aurait pour but de se rapprocher du fonctionnement d'un pancréas normal en combinant dans une pompe bicamérale de l'insuline et du glucagon. (adocia.com)
  • Nous attendons, depuis plusieurs années, la mise en place d'un spray nasal Glucagon pour faciliter le resucrage des patients diabétiques présentant des hypoglycémies sévères avec troubles de la conscience. (actusantemag.com)
  • L'administration de glucagon est contre-indiquée en cas d'hypoglycémie due à un insulinome (tumeur des cellules du pancréas sécrétant l'insuline) ou à une prise d'alcool ainsi que chez les personnes ayant un phéochromocytome (tumeur bénigne des cellules sécrétant l'adrénaline et la noradrénaline). (larousse.fr)
  • Chez les patients présentant un insulinôme, l'administration de glucagon peut entraîner une augmentation initiale de la glycémie. (lillymedical.eu)
  • Cependant, l'administration de glucagon peut stimuler, directement ou indirectement (par une augmentation initiale de la glycémie) une libération exagérée d'insuline par un insulinôme et de ce fait entraîner une hypoglycémie. (lillymedical.eu)
  • Il est important d'être conscient que l'administration de glucagon injectable chez les personnes présentant un insulinôme peut entraîner une sécrétion exagérée d'insuline par les cellules tumorales de l'insulinôme et de ce fait entraîner une hypoglycémie sévère. (lillymedical.eu)
  • Seulement 12,5% des soignants ont réalisé correctement l'administration du glucagon injectable . (type1better.com)
  • La poudre nasale est le premier produit sous licence de glucagon à ne pas être administré par injection et ne nécessitant pas de processus de mélange à plusieurs étapes. (santedesdiabetiques.com)
  • Une formulation liquide de glucagon humain pourrait être utilisée comme un traitement d'urgence de l'hypoglycémie sévère et en tant qu'agent compagnon de l'insuline dans un pancréas artificiel bi-hormonal. (mypharma-editions.com)
  • Une étude présentée lors du congrès de l'EASD en 2015 a simulé une situation d'urgence afin de comparer la capacité de membres du personnel soignant formés et d'aidants naturels, à traiter une hypoglycémie sévère à l'aide de glucagon injectable et de glucagon nasal. (type1better.com)
  • Contactez toujours les services d'urgence si le glucagon a été administré en situation d'urgence. (beyondtype1.org)
  • Le temps et le succès d'administration de cette forme s'avèrent incomparables à la forme injectable du Glucagon, qui doit être réalisée en situation d'urgence par l'entourage du patient, généralement éduqué préalablement. (actusantemag.com)
  • Le glucagon est un médicament d'urgence administré en cas de coma hypoglycémique chez le diabétique de type 1. (vidal.fr)
  • La présentation intranasale de glucagon, faisant actuellement l'objet d'études cliniques de phase III, pourrait devenir le premier dispositif d'administration sans aiguille pour le traitement d'urgence de l'hypoglycémie sévère. (locemia.com)
  • Cette étude de l'Université de Montréal (UdM) présentée dans les Actes de l'Académie des Sciences américaine (PNAS), révèle un mécanisme d'adaptation impliqué dans le contrôle de l'action de l'insuline, dans lequel le glucagon joue un rôle clé et pourrait même être un atout protecteur. (santelog.com)
  • Notre formulation du glucagon humain pourrait présenter des avantages significatifs en termes de performances et de coût, qui pourraient ouvrir de nouvelles applications thérapeutiques. (mypharma-editions.com)
  • En particulier, une solution de glucagon humain pourrait être utilisée dans des pompes dans le cadre d'indications chroniques. (adocia.com)
  • Un tel dispositif constituerait une amélioration par rapport aux pompes dites « à boucle fermée » (« closed-loop»), car l'addition de glucagon pourrait limiter le risque d'hypoglycémie à la fois la nuit et pendant la journée, rendant potentiellement le patient plus libre de ses activités (ex : exercice physique, changement inattendu dans l'emploi du temps etc. (adocia.com)
  • Cependant, l'équipe de recherche de Montréal conteste ce concept et montre que le glucagon exerce une fonction supplémentaire : il prépare le foie, de sorte qu'il soit plus sensible au signal de l'insuline et s'arrête de produire du sucre, lorsque le corps n'en a plus besoin. (santelog.com)
  • Le glucagon, en revanche, ordonne au foie d'épuiser ces réserves lorsque cela est nécessaire et de produire plus de sucre. (santelog.com)
  • Le glucagon sensibilise le foie à l'insuline : le glucagon exerce en effet une fonction supplémentaire, jusque-là non documentée : il prépare le foie à être sensible au signal de l'insuline, au petit déjeuner par exemple, où il l'induit le foie à arrêter de produire son propre sucre, car le corps en aura suffisamment par l'apport alimentaire. (santelog.com)
  • Si vous êtes conscient, mais que vous ne pouvez pas consommer de sucre par voie orale, vous pouvez vous autoadministrer du glucagon. (beyondtype1.org)
  • Le glucagon accroît la quantité de sucre dans le sang lorsque le taux de sucre est bas. (cancer.ca)
  • D'autres propriétés du glucagon sont en cours de caractérisation. (wikipedia.org)
  • Tout dernièrement est apparu un article dans le Diabetes Care de février 2016 où l'on étudiait l'efficacité du glucagon donné par voie intranasale de façon simple (voir image). (jeunediabete.com)
  • INDIANAPOLIS, octobre 9 2015 - Eli Lilly and Company (NYSE:LLY) et Locemia Solutions ont annoncé aujourd'hui que Lilly avait acquis les droits mondiaux de la présentation intranasale de glucagon de Locemia, un traitement potentiel de l'hypoglycémie sévère pour les personnes diabétiques traitées par insuline. (locemia.com)
  • Le seul traitement existant pour les formes sévères d'hypoglycémie hors du milieu hospitalier est la forme injectable de glucagon. (sante-sur-le-net.com)
  • Le glucagon injectable et ses limites. (type1better.com)
  • Le glucagon nasal offre désormais une alternative au glucagon injectable plus simple et plus sécuritaire pour traiter l'hypoglycémie sévère. (type1better.com)
  • Faster use and fewer failures with needle-free nasal glucagon versus injectable glucagon in severe hypoglycemia rescue: A simulation study. (type1better.com)
  • Jusqu'à présent, nous ne disposions que de la forme injectable du Glucagon, par voie sous-cutanée ou intramusculaire. (actusantemag.com)
  • Jusqu'à présent, le glucagon donné en urgence ne peut être administré que par voie intramusculaire et doit être reconstitué à la dernière minute car la solution est instable. (jeunediabete.com)
  • Les plus jeunes (de 4 à 11 ans) ont reçu 2 ou 3 mg de glucagon par voie nasale, ou une dose unique de glucagon calculée sur le poids par voie intramusculaire. (ajd-diabete.fr)
  • Les enfants âgés de 12 à 17 ans ont reçu 1 mg de glucagon par voie intramusculaire ou 3 mg par voie nasale. (ajd-diabete.fr)
  • Au total, les injections du glucagon en intramusculaire et en intranasal ont toutes permis de faire remonter la glycémie (en, moyenne de 25 mg/dl en 20 minutes). (ajd-diabete.fr)
  • Le glucagon induit le foie à puiser dans ses réserves : en cas de jeûne prolongé, durant la nuit, le taux de glucagon est plus élevé. (santelog.com)
  • Le fait que les acides aminés augmentent les taux de glucagon est important, car de cette manière l'hypoglycémie déclenchée par un apport excessif en protéines peut être évitée. (amelioretasante.com)
  • Les auteurs ont conclu qu'une mini dose de glucagon (150 mg) pouvait s'avérer une stratégie efficace pour prévenir l'hypoglycémie induite par l'activité physique. (type1better.com)
  • La poudre de glucagon est reconstituée avec 1,0 mL d'eau pour injection, ce qui donne une solution de 1 mg (1 UI) de glucagon et de 107 mg de lactose monohydraté par mL avant l'utilisation. (santecheznous.com)
  • Il contient une seule dose de poudre de glucagon et ne peut pas être réutilisé. (type1better.com)
  • Certains ont alors tenté développer des traitements pour inhiber l'effet du glucagon, mais cette approche s'est révélée peu concluante : l'équipe montre qu'en effet, le glucagon peut constituer un atout protecteur. (santelog.com)
  • Indométacine : peut diminuer l'effet du glucagon. (urgences-serveur.fr)
  • L'effet du glucagon est opposé à celui de l'insuline puisqu'il augmente la glycémie au lieu de la diminuer. (beyondtype1.org)
  • Le glucagon se lie son r cepteur, le r cepteur du glucagon (un r cepteur coupl une prot ine G, RCPG). (futura-sciences.com)
  • R cemment, des scientifiques du Shanghai Institute of Materia Medica (SIMM) de l'Acad mie des Sciences de Chine, en collaboration avec plusieurs groupes bas s en Chine, au Danemark, au Canada et aux tats-Unis, ont d termin la structure cristalline du GCGR en complexe avec un analogue du glucagon, NNC1702. (lelezard.com)
  • Pour pouvoir donner une injection de glucagon, il faut d'abord la préparer. (santecheznous.com)
  • La société a annoncé son intention de commercialiser le nouvel agent au même prix que son injection de glucagon actuelle. (santedesdiabetiques.com)
  • FDA OKs First-Ever Nasal Glucagon for Severe Hypos in Diabetes - Medscape - Jul 25, 2019. (santedesdiabetiques.com)
  • Le glucagon stimule la libération de catécholamines. (doctissimo.fr)
  • Sans retirer l'aiguille du flacon, agitez le flacon délicatement jusqu'à ce que le glucagon soit complètement dissous et que la solution soit transparente. (santecheznous.com)
  • Le glucagon nasal se conserve jusqu'à 2 ans et se garde à température ambiante. (type1better.com)
  • A phase 3 multicenter, open‐label, prospective study designed to evaluate the effectiveness and ease of use of nasal glucagon in the treatment of moderate and severe hypoglycemia in children and adolescents with type 1 diabetes in the home or school setting. (type1better.com)
  • La formulation nasale fonctionnait généralement aussi bien que le glucagon injecté pour inverser l'hypoglycémie induite par l'insuline, sans aucun problème majeur de sécurité. (santedesdiabetiques.com)
  • Cette nouvelle façon d'administrer du glucagon peut simplifier le processus, ce qui peut être critique pendant un épisode [d'hypoglycémie], d'autant plus que le patient peut avoir perdu conscience ou peut avoir une crise. (santedesdiabetiques.com)
  • Caractérisé par un déficit d'insuline et un excès de glucagon, le diabète cétosique a plusieurs origines. (diabeteetobesite.fr)
  • Même si à la lumière de ces conclusions il peut sembler que le glucagon s'avère la façon la plus efficace de prévenir l'hypoglycémie induite par l'activité physique, il est possible qu' une réduction plus précoce et plus importante d'insuline de même qu'une plus grande consommation de glucides puissent aussi offrir une protection raisonnable. (type1better.com)
  • Consultez un médecin pour savoir s'il serait utile d'utiliser le glucagon pour prévenir le dépassement de la glycémie ou si vous avez des antécédents d'hypoglycémie et de problèmes thyroïdiens. (beyondtype1.org)
  • Une étude qui a été publiée récemment a aussi envisagé la possibilité d'utiliser le glucagon pour prévenir l'hypoglycémie lors de la pratique d'activité physique. (type1better.com)
  • L'avènement du Glucagon sous forme de spray nasal prêt à l'emploi est donc sans conteste un progrès radical. (actusantemag.com)
  • L'illustration ci-dessus repr sente le m canisme du glucagon dans un h patocyte (cellule du foie). (futura-sciences.com)
  • L'épreuve au glucagon (associée au propanolol) permet d'apprécier la fonction somatotrope en cas de retard de croissance. (commentguerir.com)
  • Et l'activation de PGC1A ne conduit pas à une hyperglycémie (1ère fonction connue du glucagon), mais induit une meilleure réponse à l'insuline (2de fonction découverte du glucagon). (santelog.com)
  • Les réactions indésirables les plus courantes associées au glucagon nasal sont similaires à celles du glucagon injecté et comprennent des nausées, des vomissements et des maux de tête. (santedesdiabetiques.com)
  • Selon l'agence Américaine des produits alimentaires et médicamenteux, le glucagon nasal ne devrait pas être administré aux personnes atteintes de phéochromocytome ou d'insulinome . (santedesdiabetiques.com)
  • De plus, le glucagon devrait être offert dans une formule différente que celle en poudre dans laquelle le glucagon est offert actuellement pour un entreposage plus sécuritaire et une durée de conservation plus longue. (type1better.com)