Peptides mucus gastric mucins. Medical search. Frequent questions

Their functions are diverse, including protection of the mucosa, thickening of the mucus, and increasing epithelial healing rates. (wikipedia.org)
This disaccharide is an unusual glycotope that is only known to exist on the large, heavily glycosylated, mucins in the mucosa. (wikipedia.org)
The results of gastric endoscopy showed that the amount of mucous adhesion on the surface of gastric mucosa and the resolution of gastric mucosa image were positively correlated with the dosage of Streptomyces protease (0,5000,20000 units/piece). (as7abe.com)
When the dosage is 20000 units/piece, there is no mucous adhesion in the whole stomach, the gastric mucosa image is clear, and it is easy to identify the fine condition of the mucosal surface. (as7abe.com)
Coordinated localisation of mucins and trefoil peptides in the ulcer associated cell lineage and the gastrointestinal mucosa. (embl.de)
Coordinated localisation of trefoil peptides and mucins in UACL and normal gastrointestinal epithelia suggests they may assist each others' functions in protection and repair of gastrointestinal mucosa. (embl.de)
The trefoil peptide intestinal trefoil factor (ITF) plays a critical role in the protection of colonic mucosa and is essential to restitution after epithelial damage. (embl.de)
A mucus layer of variable thickness covers the mucosa of different digestive tract parts that appear more remarkable within the large intestine. (biomedcentral.com)
The two main sources of mucins within the digestive tract are the glandular acini located within the deep face of the mucosa and goblet cells dispersed throughout the gut epithelium [ 12 ]. (biomedcentral.com)
adherent gastric mucus viewed under bright field on a transverse section 1.6 mm thick) of rat gastric mucosa. (comprehensivephysiology.com)
Three distinct phases can be seen clearly: mucosa, mucus gel layer, and bathing solution. (comprehensivephysiology.com)
reepithelialized mucosa: rat gastric mucosa after exposure to 70% (vol/vol) ethanol for 45 s and rapid wash with 0.9% (wt/vol) sodium chloride followed by 0.9% (wt/vol) sodium chloride for 1 h. (comprehensivephysiology.com)
Mucosa was formalin fixed, embedded in paraffin wax, and sections were stained with periodic acid‐Schiff stain for mucin. (comprehensivephysiology.com)
Gastric mucosa showing gastric pits, pockets in the epithelium. (tennisportoroz.com)
Pathomorphological studies of gastrointestinal mucosa of asthma patients indicated increased activity of mucus-producing cells (as in the bronchi), barrier degeneration, and hyperplasia [ 10 ]. (biomedcentral.com)
Innate immune cells play a decisive role in host fate by enabling high bacterial loads and minimizing the immunological impact of this burden in the gastric mucosa. (nimml.org)
TFFs are rapidly and coordinately secreted from mucus-secreting cells when the gastrointestinal mucosa suffers mechanical and/or chemical damage, and they respond to the mucosal injury ( 4 , 5 ). (spandidos-publications.com)

Clearance of small intestinal crypts involves goblet cell mucus secretion by intracellular granule rupture and enterocyte ion transport. (gu.se)
Peptide hydrolysate significantly decreased secretion of pro-inflammatory cytokine IL-8 in lipopolysaccharide (LPS)-stimulated human colon epithelial HT-29 cells. (calbinotox.fr)
Commensal bacteria can induce the production of mucus from goblet cells by activating interleukin (IL)-22 secretion by innate lymphoid cells [ 8 ]. (ojcius.net)
Learn / Biology / Gastric Juice Secretion. (tennisportoroz.com)
The gastric phase is the second phase of gastric secretion, approximately two-thirds of the gastric secretions takes place at this phase. (tennisportoroz.com)
About two-thirds of gastric secretion occurs during this phase. (tennisportoroz.com)
Despite progress in animal studies, the genes and their expression pattern involved in mucus production and secretion in human airway epithelium are not well understood. (biomedcentral.com)
We hypothesized that comparison of the transcriptomes of the small airway epithelium of individuals that express high vs low levels of MUC5AC, the major macromolecular component of airway mucus, could be used as a probe to identify the genes related to human small airway mucus production/secretion. (biomedcentral.com)
This strategy identified both mucus production and secretion related genes under control of a network composed of multiple transcription factors. (biomedcentral.com)
mucus secretion-related regulator and mucus hypersecretory-related ion channel. (biomedcentral.com)
Little is known about the gene networks associated with the synthesis and secretion of mucins in the human small airway epithelium. (biomedcentral.com)
This novel strategy enabled identification of a 73 "MUC5AC-associated core gene" list with 9 categories, which control a series of processes from mucin biosynthesis to mucus secretion. (biomedcentral.com)
The process of mucus production and secretion is central to the normal defense of the lung, with mucus an important component of the airway mucociliary escalator that continuously cleanses the lung of inhaled particulates, pathogens and xenobiotics [ 1 ]. (biomedcentral.com)
In contrast acquaporin 5 is usually expressed in submucosal glands and has been shown to regulate mucus secretion and hydration [16]. (researchtoactionforum.org)
CagA is an effector protein injected into the gastric epithelial cells by a type IV secretion system encoded by the cag pathogenicity island (cagPAI). (nimml.org)

Trefoil factors (TFF) are secretory products of mucin producing cells. (wikipedia.org)
4 The proteins that occur in the mucus, including lactoferrin, lysozyme, and secretory IgA, are part of this defence system. (bmj.com)
Further studies should identify if TFF3 affects mucus sensing of dendritic cells and how TFF3 is involved in regulating the immune response as an intrinsic secretory peptide of immune cells. (akjournals.com)
The stomach is surrounded by parasympathetic (stimulant) and sympathetic (inhibitor) plexuses (networks of blood vessel s and nerve s in the anterior gastric, posterior, superior and inferior, celiac and myenteric), which regulate both the secretory activity of the stomach and the motor (motion) activity of its muscles. (explained.today)

Gel-forming mucins are large high-molecular weight secreted O-glycoproteins responsible for the gel-properties of the mucus blanket. (ox.ac.uk)
BACKGROUND AND AIMS: Trefoil factor family (TFF) peptides and the chromosome 11p15.5 mucin glycoproteins are expressed and secreted in a site specific fashion along the length of the gastrointestinal tract. (embl.de)
The gut barrier consists of the mucus layer, commensal bacteria, epithelial cells, and immune cells residing in the lamina propria (see Glossary ) ( Figure 1 A). In the intestinal epithelium, goblet cells secrete mucus glycoproteins that prevent direct contact between gut microbes and colonocytes [ 2 ], while the mucus in the small intestine is loose and allows passage of bacteria [ 3 ]. (ojcius.net)
Mucus comprises water, glycoproteins (mucins), and ions. (bmj.com)
Composite diagram of proposed structures for typical branched oligosaccharides in human 223 and pig 219 gastric mucin glycoproteins showing the immunodeterminant blood group A and H (- - -) and I (‐ ‐ ‐) saccharide structures. (comprehensivephysiology.com)

By cross-linking mucins through the bivalent binding of this glycotope, the trefoil factors are then able to reversible modulate the thickness and viscosity of the mucus. (wikipedia.org)
Streptomyces protease can reduce the viscosity of gelatin and mucin in the pH range of 7.0 ~ 10.0, and has the strongest effect on reducing mucin in gastric mucus compared with other protein-breaking enzymes. (as7abe.com)
dependence of solution viscosity of pig gastric mucus on glycoprotein concentration. (comprehensivephysiology.com)
In COPD patients the impaired mucociliary function may be due to a ADX-47273 combination of excessive mucus production increased viscosity of mucus due to acquired dysfunction of CFTR reduced acquaporin 5 expression and reduced ciliary beating. (researchtoactionforum.org)

Our previous study displayed that this activity could be partially due to peptide(s) generated by trypsin hydrolysis of the surface proteins of S. thermophilus LMD-9. (calbinotox.fr)
We hypothesized that peptides released from the surface proteins of this bacterium during digestion could be implied in this activity. (calbinotox.fr)
Consequently, we prepared a peptide hydrolysate by shaving and hydrolysis of surface proteins using trypsin, and the origin of peptides was checked by liquid chromatography-tandem mass spectrometry (LC-MS/MS) analysis. (calbinotox.fr)
Most of the identified peptides originated from bacterial cell surface proteins. (calbinotox.fr)
Commensals also convert dietary fiber into short-chain fatty acids (SCFAs), which protect the gut barrier in various ways, including by providing energy for colonocytes and stimulating the production of mucus, antimicrobial proteins, and Treg cells [ 5 ]. (ojcius.net)
We assessed changes in the gut microbiota, intestinal permeability, gut peptides, intestinal epithelial tight-junction proteins ZO-1 and occludin (qPCR and immunohistochemistry), hepatic and systemic inflammation. (bmj.com)
These proteins have revealed many aspects of the relationships between the bacteria, the gastric mucosal surface, and the final outcome of the disease. (nimml.org)

Using immunohistochemistry, we showed that the antibody reacted strongly with deep glands of duodenum and ileum and mucous neck cells of gastric body. (ox.ac.uk)
That the steroid hormones cannot 2002), c-myc the growth of gastric mucin, cells that produce mucous. (pourchat.com)
Mucinases are enzymes capable of degrading mucins (the complex high molecular weight molecules that are the major non-aqueous components of mucous gels). (bmj.com)

Evidence for coexpression of mucins and trefoil peptides has been suggested in numerous gastrointestinal mucosal pathologies. (embl.de)
The ulcer associated cell lineage (UACL) occurs at sites of chronic ulceration in Crohn's disease, expresses all three trefoil peptides, and is implicated in mucosal restitution. (embl.de)
We tested the hypothesis that individual trefoil peptides are uniquely localised with specific mucins in the UACL and normal gastrointestinal epithelia. (embl.de)
Colocalisation of mucins and trefoil peptides was demonstrated by immunofluorescent colabelling in UACL and normal gastrointestinal epithelia. (embl.de)
This review highlights some of the major findings pertinent to the epidermal growth factor (EGF) receptor and its ligands, particularly the major gut ligand transforming growth factor-alpha, as well as the trefoil peptides. (embl.de)

Surface protease PrtS could be the source of these peptides during gastrointestinal digestion. (calbinotox.fr)
Therefore, peptide hydrolysates were obtained by shaving two phenotypically distinct strains of S. thermophilus (LMD-9 PrtS+ and CNRZ-21N PrtS−) with pepsin, a gastric protease, followed or not by trypsinolysis. (calbinotox.fr)

Digestion can be divided into three stages - the oral phase (mouth), the gastric phase (stomach) and the intestinal phase (small intestine)- depending on the position of food within the digestive tract. (tennisportoroz.com)

IgA is present in vaginal and rectal secretions, in saliva, gastric fluid, tears, sweat and in colostrum as well as mature milk. (biomedcentral.com)

The use of genetically engineered mice with both gain-of-function and loss-of-function mutations has been particularly informative about the normal and pathophysiological actions of a number of regulatory peptides of the gastrointestinal tract. (embl.de)
Therefore, peptides released from either PrtS+ or PrtS− strains in the gastrointestinal tract during digestion of a product containing this bacterium may display anti-inflammatory effects and reduce the risk of inflammation-related chronic diseases. (calbinotox.fr)

These findings suggest that TFF can activate intestinal epithelial cells and could actively participate in the immune system of breastfed babies by inducing the production of peptides related to innate defence, such as defensins. (wikipedia.org)

The characterization of the first anti-mouse Muc6 antibody shows an increased expression of the mucin in pancreatic tissue of Cftr-knockout mice. (ox.ac.uk)
The rabbit anti-mouse Muc6 polyclonal antibody seems highly specific to the mouse mucin and will be useful to study pancreatic pathology in cystic fibrosis. (ox.ac.uk)
Nicholas Robinson , an eighteenth-century English physician, mixed saliva with bile and pancreatic, gastric, and intestinal juices to dissolve "all manner of viscous humors and fabulous concretions. (wustl.edu)

In Western blot experiments, the antibody detected a high-molecular weight molecule secreted by the gastric tissue. (ox.ac.uk)

The average person produces about a gallon of mucus each day, and it covers a very large surface area of wet cells in the body. (mit.edu)
When mucus dries out, the cells they protect don't work as well. (mit.edu)
Yeast cells in mucins remain in the benign form, which the body presumably can tolerate," she says. (mit.edu)
The results indicate that many intestinal bacteria may coexist with and confer benefits to the host by mechanisms not attributable to adhesion to epithelial cells or mucus. (biomedcentral.com)
The peptide hydrolysates of both strains exhibited anti-inflammatory action through the modulation of pro-inflammatory mediators in LPS-stimulated THP-1 macrophages (COX-2, Pro-IL-1β, IL-1β, and IL-8) and LPS-stimulated HT-29 cells (IL-8). (calbinotox.fr)
They were mainly localized in the acini of the esophageal glands and SPG, gastric surface epithelium, duct system of DPG, and intestinal goblet cells. (biomedcentral.com)
ASL is made up of two layers an upper viscoelastic layer of mucins secreted by the goblet cells and submucosal glands and a lower periciliary layer made up of large membrane-bound glyocproteins as well as tethered mucins (muc-1 muc-4 and muc-16) [13 14 The periciliary layer is relatively less viscous and acts as a lubricating layer for cilia to beat. (researchtoactionforum.org)
As shown in figure 1, the inflammatory response towards H. pylori is initiated through the interaction between the pathogen lipopolysaccharides (LPS) and the Toll-like receptors (TLR) expressed on gastric epithelial cells [ 6 ]. (nimml.org)

Partial or complete degradation of mucin molecules by microbial enzymes is often a fundamental step in disruption of defensive mucosal barriers, as these constitute direct interfaces between internal and external environments. (bmj.com)
Given the complexity of the host- H. pylori interactions at the systems level and the broad range of possible outcomes, our team has developed a computational model of the gastric mucosal immune response towards H. pylori infection. (nimml.org)

Potential (unmodified) amino-terminal click here tryptic peptides (MKRKNILKFISLLGIGSFVMLAAASCTTPVLENR, CTTPVLENR or SCTTPVLENR) were not identified. (akt-signal.com)

Mucus has an integrated antibacterial function. (bmj.com)

decode an intriguing paradox: excessive antimicrobial peptide-regenerating family member 3 (REG3) expression in inflammatory bowel disease (IBD) patients depletes protective enterococci. (x-mol.com)
Gene ontology implicated the immune system, including interleukins 4 and 13, as well as antimicrobial peptides in this overexpression. (biomedcentral.com)

Betacellulin (BTC) belongs to the epidermal growth factor (EGF) family of peptide ligands that are characterised by a six-cysteine consensus motif that forms three intra-molecular disulfide bonds crucial for binding the ErbB receptor family. (embl.de)

The role of hydrolytic enzymes in the pathogenesis of sexually transmitted diseases and their effect on cervical mucus are discussed in this review. (bmj.com)
The possible contribution of mucin degrading enzymes to the pathogenesis of infection is, therefore, not to be underestimated. (bmj.com)
1, 2 This review approaches the role of mucin degrading enzymes from the potential interaction of micro-organisms with the cervical mucus barrier, and discusses the contribution that mucin degrading enzymes may make to microbial colonisation of the reproductive tract. (bmj.com)

METHODS: Expression of mucin genes in the UACL from small bowel tissue of patients with Crohn's disease was detected by in situ hybridisation, and localisation of the products by immunohistochemistry. (embl.de)

TFF comprises the gastric peptides (TFF1), spasmolytic peptide (TFF2), and the intestinal trefoil factor (TFF3, this protein). (wikipedia.org)

The most overexpressed genes included Fc Fragment of IgG Binding Protein ( FCGBP , logFC = 3.01, pFDR = 0.015), Mucin 2 ( MUC2 , logFC = 2.78, pFDR = 0.015), and Alpha 1B Defensin ( DEFA1B , logFC = 2.73, pFDR = 0.024). (biomedcentral.com)

Here, we hypothesised that prebiotic modulation of gut microbiota lowers intestinal permeability, by a mechanism involving glucagon-like peptide-2 (GLP-2) thereby improving inflammation and metabolic disorders during obesity and diabetes. (bmj.com)
Helicobacter pylori colonizes half of the world's population as the dominant member of the gastric microbiota resulting in a lifelong chronic infection. (nimml.org)

gastric shield A chitinized plate in the stomach of a bivalve (phylum Mollusca) on which the crystalline style is rotated. (tennisportoroz.com)
gastric [gas´trik] pertaining to, affecting, or originating in the stomach. (tennisportoroz.com)
Ingested food stimulates gastric activity in two ways: by stretching the stomach and by raising the pH of its contents. (tennisportoroz.com)
gastric ulcer.Relating to the stomach. (tennisportoroz.com)
Laparoscopic gastric plication is a newer minimally invasive weight-loss surgery technique that reduces the size of the stomach capacity to approximately 3 ounces. (tennisportoroz.com)
The partly digested food or ingested food triggers the gastric activity in two possible ways - by stretching the stomach. (tennisportoroz.com)
They occur in the body and fundus of the stomach and secrete HCl, pepsinogen and soluble mucin. (tennisportoroz.com)
You use gastric to describe processes, pain, or illnesses that occur in someone's stomach. (tennisportoroz.com)
Gastric definition is - of or relating to the stomach. (tennisportoroz.com)
gastric analysis analysis of the stomach contents by microscopy and tests to determine the amount of hydrochloric acid present. (tennisportoroz.com)
The stomach is involved in the gastric phase of digestion, following chewing . (explained.today)
The stomach secretes digestive enzyme s and gastric acid to aid in food digestion. (explained.today)
The lesser curvature of the human stomach is supplied by the right gastric artery inferiorly and the left gastric artery superiorly, which also supplies the cardiac region. (explained.today)
The fundus of the stomach, and also the upper portion of the greater curvature, is supplied by the short gastric arteries , which arise from the splenic artery. (explained.today)

CONCLUSIONS: The UACL has a unique profile of mucin gene expression. (embl.de)
And approximately 140 peptide therapeutics are currently being evaluated enlargement due to steroid usage respectively, which are encoded by the same gene, CYP11B2. (pourchat.com)

For a long time, Ribbeck says, mucus was thought to function mostly as a structural barrier to germs. (mit.edu)

Gastric Motility and Secretin. (tennisportoroz.com)

The identification of the genes associated with increased airway mucin production in humans should be useful in understanding the pathogenesis of airway mucus hypersecretion and identifying therapeutic targets. (biomedcentral.com)

Cystic fibrosis, premature childbirth, and dry eye are all linked to unhealthy changes in the bodily mucus that limits bad germs and lubricates the lungs, eyes, and other organs. (mit.edu)

The picture is emerging that mucus is very good at preventing virulence of certain microbes," Ribbeck says. (mit.edu)
Mucus has the ability to keep microbes in check - to keep them in a commensal, compatible way, so that they live on us but don't cause harm. (mit.edu)
We are asking how microbes change their behavior when they get exposed to the mucins," Ribbeck says. (mit.edu)
Bit by bit, with genetic perturbations of the microbes, and biochemical dissection of the mucins, we can begin to understand the mechanisms of interaction between the mucins and the microbes. (mit.edu)

However the clinical utility of such a test may be limited by frequent staining of TFF3 in gastric cardia and subsequent risk of false positives. (wikipedia.org)
The peptide trefoil factor family 3 (TFF3) is a major constituent of the intestinal mucus, playing an important role in the repair of epithelial surfaces. (akjournals.com)

The mucins provide the lubrication that lets the eyelid slide smoothly. (mit.edu)
Artificial tear fluids contain the salt, but they lack the mucins, and that lubrication is not so easy to reconstitute with synthetic components," Ribbeck says. (mit.edu)
This layer is rich in mucosubstances or mucins that are known to play important roles in lubrication and protection of the underlying layers via limiting their exposure to toxins and pathogens [ 10 ]. (biomedcentral.com)

dippt cas no 135252-10-7 dissolves and removes gastric mucus by severing the peptide bonds of mucin, the main component of gastric mucus. (as7abe.com)

Subunits are joined by disulfide bridges to form overall linear polymeric mucins. (comprehensivephysiology.com)

Mucus doesn't kill them, but it prevents them from doing bad things, for example, colonizing your epithelial surfaces and expressing certain virulence factors. (mit.edu)

4) Role of intestinal mucins as a defense mechanism against rotavirus. (stanford.edu)

Mucus depends on mucins, biopolymers with a protein backbone and an attached forest of sugar molecules. (mit.edu)
We're dissecting the mechanisms now by which the mucins do that, to then build synthetic molecules that can do the same job. (mit.edu)
This can be explained by the large hydrated glycoprotein molecules at higher concentrations occupying the whole solution volume and their overlapping molecular domains interacting noncovalently to form the mucus‐gel matrix. (comprehensivephysiology.com)
Pepsin breaks down protein molecules of … The procedure does not involve the use of an implanted device (such as gastric banding). (tennisportoroz.com)

The anti-inflammatory activity of peptide hydrolysate was investigated under inflammatory conditions in two cell models. (calbinotox.fr)

HIV, influenza, papilloma virus, herpes virus - all need to pass through mucus to achieve infection, and usually your mucus is really good at preventing them from passing through. (mit.edu)
However, a small percentage of infected individuals will ultimately develop duodenal ulcers and gastric cancer due to the inability of the host immune system to clear the infection. (nimml.org)

3 In the female reproductive tract a primary function of the cervical mucus is the defence of the upper reproductive tract from microbial invasion. (bmj.com)

and (B) by synthetic peptides, such as SLIGKV, that bind to the receptor, mimicking the actions of agonist proteases. (wikipedia.org)
X. Trefoil peptide and EGF receptor/ligand transgenic mice. (embl.de)

Native gastric mucus and mucus reconstituted from isolated glycoprotein have the behavior characteristic of a weak viscoelastic gel with the elastic modulus dominant over the viscous modulus. (comprehensivephysiology.com)
Reduced and proteolytically digested mucus has the behavior of viscous liquid where the viscous modulus is dominant over the loss modulus for much of the frequency range accessed. (comprehensivephysiology.com)

The researchers concluded there was acids are, by convention, called peptides unclear, but their existence in vivo has been clearly shown in various settings including human studies. (pourchat.com)

Katharina Ribbeck , the Eugene Bell Career Development Professor of Tissue Engineering at MIT, is leading an effort to understand how mucus works and to develop substitutes for when natural mucus production fails. (mit.edu)
Prebiotic increased the endogenous intestinotrophic proglucagon-derived peptide (GLP-2) production whereas the GLP-2 antagonist abolished most of the prebiotic effects. (bmj.com)

Nothing like the strong stuff, blood and urine and sweat and mucus. (wustl.edu)

mechanical spectrum for pig gastric mucus showing a plot of elastic (storage modulus, --) and viscous (loss modulus, --) moduli against frequency of oscillatory deformations 20. (comprehensivephysiology.com)

Five orthologous gel-forming mucins have been cloned in human and mouse. (ox.ac.uk)
Concentration of glycoprotein in gastric mucus (pig and human) is ∼50 mg/ml. (comprehensivephysiology.com)

Once in the gastric lamina propria, H. pylori is mainly found inside macrophages where their interaction leads to macrophage activation and cytokine release [ 7 ]. (nimml.org)

Chronic dry eye results from a lack of mucins, and current remedies are less than ideal. (mit.edu)
Mucus hypersecretion contributes to the morbidity and mortality of smoking-related lung diseases, especially chronic obstructive pulmonary disease (COPD), which starts in the small airways. (biomedcentral.com)

Healthy mucus is remarkable for its ability to absorb large amounts of water. (mit.edu)

Handbook of Biologically Active Peptides ( 2 nd edition), ed. (akjournals.com)

None of the strains bound to porcine mucus. (biomedcentral.com)

Aquaporin 3 and 4 are expressed in the basolateral plasmamembrane and their role hydration of mucus is not established. (researchtoactionforum.org)

Artificial tear fluid is only one type of material that could take advantage of mucins, or mucin-like polymers. (mit.edu)

Katharina Ribbeck, the Eugene Bell Career Development Professor of Tissue Engineering at MIT, diagrams the molecular structure of mucin, which has a protein backbone and a brushlike array of attached sugars, or glycans. (mit.edu)
Both of these peptide families have important local actions in maintaining tissue homeostasis and repair after injury, and when mechanisms governing their regulation are disrupted they may contribute to disease progression. (embl.de)

Anatomy4

Organisms2

Chemicals and Drugs9

Phenomena and Processes2

Information Science1

Mucosa17

Secretion15

Secretory4

Glycoproteins5

Viscosity4

Proteins7

Mucous3

Trefoil peptides5

Protease2

Small intestine1

Secretions1

Gastrointestinal2

Intestinal epithelial1

Pancreatic3

High-molecular weight1

Cells8

Mucosal2

Tryptic1

Antibacterial1

Antimicrobial2

Epidermal growth1

Enzymes3

Immunohistochemistry1

Comprises1

MUC21

Microbiota2

Stomach14

Gene2

Barrier1

Secretin1

Pathogenesis1

Lubricates1

Microbes4

TFF32

Lubrication3

Bonds1

Disulfide1

Epithelial surfaces1

Defense1

Molecules4

Inflammatory1

Infection2

Defence1

Receptor2

Behavior2

Vivo1

Production2

Sweat1

Viscous1

Human2

Interaction1

Chronic2

Absorb1

Handbook1

Strains1

Role1

Fluid1

Tissue2