Metabotropic receptorsDiphosphateInhibitionAdenylyl cyclaseGlutamateProteinDopamineAntagonistThromboxaneInducesNitric oxideBindsSerotoninActivated C-KinaseMechanismIonotropicModulatesExertActivatesProteinsThrombinCannabinoidGlucocorticoidInteractionsMediatorsVascularPotassium channelNucleosideMetabolismRegulationInflammationChronic2016CalciumLungCellAsthmaInteractionCellsAminoTypeStructuralDemonstrateExpressSignalDataProductionStructure
Metabotropic receptors3
- These data suggest that glutamate, acting at several metabotropic receptors expressed by astrocytes, could modulate glial activity evoked by neurotransmitters and thereby influence the ongoing modulation of neurons by astrocytes. (jneurosci.org)
- Metabotropic receptors, or G-protein coupled receptors , are membrane proteins that gets activated by a ligand-binding. (greek.doctor)
- This is slower than the ionotropic receptors and so drugs which act by metabotropic receptors may have slower action. (greek.doctor)
Diphosphate4
- RESULTS: Fresh PLTs responded to the dual agonists arachidonic acid and adenosine diphosphate (ADP) to aggregate and produce thromboxane A2, and in both the PLT surface markers P-selectin and GPIIb-IIIa increased and GPIb decreased after stimulation. (umassmed.edu)
- a component of adenosine triphosphate and adenosine diphosphate. (adxs.org)
- In our previous study, several compounds extracted from this herb, including luteolin‑4'‑O‑β‑D‑glucopyranoside (LGP), were revealed to exert inhibitory effects on adenosine diphosphate (ADP)‑induced platelet aggregation. (spandidos-publications.com)
- Upon vascular injury, platelets are exposed to the subendothelium, and several agonists, including adenosine diphosphate (ADP) and thrombin, are generated at the injury site, which can stimulate platelet adhesion, activation and aggregation. (spandidos-publications.com)
Inhibition5
- In hypothalamic neurons, modulators such as neuropeptide Y (NPY) and adenosine depress glutamatergic transmission by either a pertussis toxin (PTx)-sensitive G-protein-coupled pathway or by inhibition of voltage-activated calcium channels (VACCs). (jneurosci.org)
- Although the exact mechanism by which adenosine receptor activation relaxes vascular smooth muscle is not known, there is evidence to support both inhibition of the slow inward calcium current reducing calcium uptake, and activation of adenylate cyclase through A2 receptors in smooth muscle cells. (globalrph.com)
- The antiinflammatory actions of corticosteroids are also thought to involve inhibition of cytosolic phospholipase A2 (through activation of lipocortin-1 (annexin)) which controls the biosynthesis of potent mediators of inflammation such as prostaglandins and leukotrienes. (pharmfair.com)
- These inhibitory effects may be associated with its dual‑receptor inhibition on P2Y12 and TP receptors. (spandidos-publications.com)
- Acute physiological elevation of IL-6 suppressed blood sugar metabolism and triggered insulin level of resistance by raising SOCS3 and via SOCS3-mediated inhibition of insulin receptor substrate (IRS)-1 and perhaps AMPK in center. (cancer-ecosystem.com)
Adenylyl cyclase2
- Regulation of responsiveness at D2 dopamine receptors by receptor desensitization and adenylyl cyclase sensitization. (aspetjournals.org)
- Note that norepinephrine and epinephrine bind to β1 and β2-receptors, which activates G s which activates adenylyl cyclase, but acetylcholine and adenosine bind to muscarinic type 2 and adenosine type 1 receptors, which activates G i protein which inhibits adenylyl cyclase. (greek.doctor)
Glutamate4
- Although metabotropic glutamate receptor (mGluR) modulation has been studied extensively in neurons, it has not been investigated in astrocytes. (jneurosci.org)
- Suprachiasmatic nucleus (SCN) and cortical astrocytes showed striking differences in sensitivity to glutamate and to mGluR agonists, even after several weeks in culture. (jneurosci.org)
- At the same time, adenosine modulates striatal DA release by stimulating glutamate release at adenosine receptors in the striatum , which increases dopamine levels. (adxs.org)
- An influential model for the pathophysiology of schizophrenia due to low activity of t by N-methyl-D-aspartate / glutamate receptor is, is an essential component of the disease. (cd177signaling.com)
Protein7
- Thrombin cleaves its G-protein-linked seven-transmembrane domain receptor, thereby releasing a 41-aa peptide and generating a new amino terminus that acts as a tethered ligand for the receptor. (umassmed.edu)
- Activator of protein kinase A (cyclic AMP agonist). (biolog.de)
- The signal transduction of G-protein coupled receptors occurs in the range of seconds. (greek.doctor)
- Perilipin 5 (PLIN5) is a lipid-droplet-associated protein that coordinates intracellular lipolysis in highly oxidative tissues and is thought to regulate lipid metabolism in response to phosphorylation by protein kinase A (PKA). (uci.edu)
- DEC-205 (CD205), a member of the macrophage mannose receptor protein family, is the prototypic endocytic receptor of dendritic cells, whose ligands include phosphorothioated cytosine-guanosine (CpG) oligonucleotides, a motif often seen in bacterial or viral DNA. (uci.edu)
- Here we describe the 3.2 Å cryo-EM structure of human DEC-205, thereby illuminating the structure of the mannose receptor protein family. (uci.edu)
- Here, we report that the guanine nucleotide-binding protein (G protein)-coupled receptor-activated WD-repeat Gβ interacts with the glucocorticoid receptor (GR), comigrates with it into the nucleus and suppresses GR-induced transactivation of the glucocorticoid-responsive genes. (rupress.org)
Dopamine2
- Adenosine receptors are closely associated with dopamine receptors and form heteromer s with them. (adxs.org)
- Linkage and comparative mapping studies indicate that the transferred chromosome segment contains a number of candidate genes for hypertension, including genes encoding a brain dopamine receptor and a renal epithelial potassium channel. (jci.org)
Antagonist1
- Gamma-butyrolactone antagonism of the picrotoxin receptor: comparison of a pure antagonist and a mixed antagonist/inverse agonist. (aspetjournals.org)
Thromboxane5
- Characterization of a thromboxane A2/prostaglandin H2 receptor in guinea pig lung membranes using a radioiodinated thromboxane mimetic. (aspetjournals.org)
- BACKGROUND: Studies have been performed on human fresh, liquid-preserved, and cryopreserved platelets (PLTs) to assess PLT-adhesive surface receptors, PLT membrane procoagulant activity, PLT aggregation, and thromboxane production. (umassmed.edu)
- STUDY DESIGN AND METHODS: In both human and baboon fresh and lyophilized PLTs, aggregation response and PLT production of thromboxane A2 were measured after stimulation, and PLT surface markers P-selectin, glycoprotein (GP) Ib, GPIIb-IIIa, and factor (F) V were measured before and after stimulation. (umassmed.edu)
- It was also found that LGP exhibited marked inhibitory effects on the activation of αIIbβ3 integrin, the secretion of serotonin from granules, and the synthesis of thromboxane A2. (spandidos-publications.com)
- Data from a radiolabeled ligand‑binding assay indicated that LGP exhibited apparent competing effects on thromboxane receptor (TP) and P2Y12 receptors. (spandidos-publications.com)
Induces1
- Minoxidil induces cell growth factors such as VEGF, HGF, IGF-1 and potentiates HGF and IGF-1 actions by the activation of uncoupled sulfonylurea receptor on the plasma membrane of dermal papilla cells. (wikipedia.org)
Nitric oxide2
- Moreover, minoxidil contains a nitric oxide moiety and may act as a nitric oxide agonist. (wikipedia.org)
- The process of ischemia and reperfusion is known to cause inducible nitric oxide synthase induction and activation, and there is evidence that interleukin (IL)-1β (46), IL-1 receptor (47), and IL-1 receptor along with nuclear factor-kappa beta (48) may have an important role in that induction. (ectrx.org)
Binds5
- Binds to the glucocorticoid receptor. (pharmfair.com)
- Part of this adenosine is discharged from the cell and binds to adenosine receptors of neighboring cells, which is supposed to compensate for the disturbed balance between energy consumption and energy supply. (adxs.org)
- Ionotropic receptors, more commonly known as ligand-gated ion-channels , are ion channels that are opened when a ligand binds to it. (greek.doctor)
- This means that, for example, when adrenaline binds to the β-receptor on a cell, adrenergic effects in the cell will increase . (greek.doctor)
- When adrenaline binds to the α 2 -receptor, adrenergic effects in the cell will decrease . (greek.doctor)
Serotonin2
- MCs can secrete nociceptor sensitizing and activating agents, such as serotonin, prostaglandins, histamine, and proteolytic enzymes that can also activate the pain-mediating transient receptor potential vanilloid channels. (frontiersin.org)
- Examples of ionotropic receptors are the nicotinic acetylcholine receptor, the GABA A receptor or the 5-HT 3 serotonin receptor. (greek.doctor)
Activated C-Kinase1
- This study demonstrated that the Receptor for Activated C-Kinase 1 (RACK1) is important in SC function. (sdbonline.org)
Mechanism1
Ionotropic1
- The signal transduction of ionotropic receptors is very fast, so drugs which act by ionotropic receptors act quickly. (greek.doctor)
Modulates1
- Carcolé M, Kummer S, Gonçalves L, Zamanillo D, Merlos M, Dickenson AH, Fernández-Pastor B, Cabañero D, Maldonado R. Sigma-1 receptor modulates neuroinflammation associated with mechanical hypersensitivity and opioid tolerance in a mouse model of osteoarthritis pain. (upf.edu)
Exert2
- Adenosine is thought to exert its pharmacological effects through activation of purine receptors (cell-surface A1 and A2 adenosine receptors). (globalrph.com)
- These two receptors bind the same ligands (adrenaline, noradrenaline) but exert opposite changes in the cell. (greek.doctor)
Activates1
- When the receptor is activated, the Gα subunit will bind GTP instead of GDP, which activates it. (greek.doctor)
Proteins1
- Outcomes Diet-induced weight problems reduced cardiac blood sugar fat PTK787 2HCl burning capacity GLUT and AMP-activated proteins kinase (AMPK) amounts which was connected with increased degrees of macrophages toll-like receptor 4 suppressor of cytokine signaling 3 (SOCS3) and cytokines in center. (cancer-ecosystem.com)
Thrombin1
- Peptides corresponding to the new amino terminal end of the proteolyzed seven-transmembrane domain thrombin receptor [TR42-55, SFLLRNPNDKYEPF, also known as TRAP (thrombin receptor-activating peptide)], previously have been demonstrated to activate the receptor. (umassmed.edu)
Cannabinoid3
- Cannabinoid type-1 receptor blockade restores neurological phenotypes in two models for Down syndrome. (upf.edu)
- One of the systems intensely studied in recent years is the endocannabinoid signaling pathway, as light was shed over a series of important interactions of cannabinoid receptors with biochemical pathways, specifically for sepsis. (encyclopedia.pub)
- Furthermore, a series of important implications on inflammation and the immune system that are induced by the activity of cannabinoid receptors stimulated by the delta-9-tetrahydrocannabinol (Δ9-THC) and cannabidiol (CBD) have been noticed. (encyclopedia.pub)
Glucocorticoid2
- In the management of asthma, the glucocorticoid receptor complexes down-regulates proinflammatory mediators such as interleukin-(IL)-1, 3, and 5, and up-regulates anti-inflammatory mediators such as IkappaB [inhibitory molecule for nuclear factor kappaB1], IL-10, and IL-12. (pharmfair.com)
- Extracellular stimuli that activate cell surface receptors modulate glucocorticoid actions via as yet unclear mechanisms. (rupress.org)
Interactions1
- Taking advantage of the diverse γδ TCR repertoire or other ligand-receptor interactions, γδ T cells can recognize a broad spectrum of tumor-associated antigens (TAAs) in a major histocompatibility complex (MHC)-independent manner, thereby activating downstream pleiotropic effects. (explorationpub.com)
Mediators1
- These data indicate that GLP-1R agonists down-regulate innate inflammatory responses to endotoxins or endogenous inflammatory mediators. (justia.com)
Vascular2
- Adenosine is a potent vasodilator in most vascular beds, except in renal afferent arterioles and hepatic veins where it produces vasoconstriction. (globalrph.com)
- Adenosine may also lessen vascular tone by modulating sympathetic neurotransmission. (globalrph.com)
Potassium channel1
- Minoxidil is an adenosine 5'-triphosphate-sensitive potassium channel opener, causing hyperpolarization of cell membranes. (wikipedia.org)
Nucleoside1
- The intracellular uptake of adenosine is mediated by a specific transmembrane nucleoside transport system. (globalrph.com)
Metabolism3
- Intracellular metabolism of 5,10-dideazatetrahydrofolic acid in human leukemia cell lines. (aspetjournals.org)
- IL-6 reduces blood sugar fat burning capacity by suppressing AMPK and insulin PTK787 2HCl receptor substrate (IRS)-linked insulin signaling in center whereas IL-6-deficient mice are covered from diet-induced modifications in blood sugar metabolism. (cancer-ecosystem.com)
- The actual fact that severe lipid infusion escalates the inflammatory response and impairs myocardial blood sugar metabolism like the ramifications of high-fat nourishing suggests the function of nutritional tension in the activation of toll-like receptor (TLR) 4 signaling and irritation in center. (cancer-ecosystem.com)
Regulation1
- The molecular underpinnings common to and connecting these disorders are not known, but may include shared genetic risk factors ( 1 , 8 ), regulation of brain cations ( 9 , 10 ), or common receptor signaling events that activate pain ( 11 ), inflammation ( 12 ), or oxidative ( 13 ) pathways. (frontiersin.org)
Inflammation4
- The present disclosure relates to glucagon-like peptide-1 receptor (GLP-1R) agonists and methods of treating or preventing allergic inflammation and/or methods of treating or preventing respiratory syncytial virus (RSV) infection. (justia.com)
- In addition, the GLP-1R agonist, exendin-4, reduced serum inflammatory cytokines during LPS-induced endotoxemia, liver inflammation, and aortic atherosclerosis in a rodent model. (justia.com)
- Recent advances in our understanding of the role of histamine and its four receptors suggest new approaches which target the histamine receptors alone or as combination therapies to more efficiently combat pruritus and inflammation in atopic dermatitis. (springeropen.com)
- Acute lipid infusion triggered inflammation and elevated local degrees of macrophages C-C theme chemokine receptor 2 SOCS3 and cytokines in center. (cancer-ecosystem.com)
Chronic2
- Formoterol is a long-acting (12 hours) beta2-agonist used in the management of asthma and/or chronic obstructive pulmonary disease (COPD). (pharmfair.com)
- Carcolé M, Zamanillo D, Merlos M, Fernández-Pastor B, Cabañero D, Maldonado R. Blockade of the sigma-1 receptor relieves cognitive and emotional impairments associated to chronic osteoarthritis pain. (upf.edu)
20161
- Their primary function is to eliminate bacteria or other damaging substances mainly via phagocytosis, i.e., the engulfment of foreign bodies inside intracellular vacuoles (phagosomes) and their disposition ( Gordon, 2016 ). (frontiersin.org)
Calcium2
- The type III mGluR agonist l -2-amino-4-phosphonobutyrate consistently inhibited 5HT-evoked calcium rises, whereas in a smaller number of cells quisqualate and L-CCG-I showed both inhibitory and additive effects. (jneurosci.org)
- Changes in intracellular calcium not only modify glial physiology, but they also seem to be involved in complex intercellular communication networks (for review, see Finkbeiner, 1993 ). (jneurosci.org)
Lung1
- However, no studies have reported the effect of GLP-1R agonists on lung IL-33 expression or release, the effect of GLP-1R agonists on the innate allergic inflammatory response that is mediated by ILC2, or the effect of GLP-1R agonists on respiratory syncytial virus (RSV) infection. (justia.com)
Cell3
- Once inside the cell, adenosine is rapidly phosphorylated by adenosine kinase to adenosine monophosphate, or deaminated by adenosine deaminase to inosine. (globalrph.com)
- Among other things, adenosine is used for autoregulation in the event of an imminent lack of energy in the cell (e.g. when the cell's performance is overloaded or when there is a lack of oxygen): If the ATP content in a cell drops, more adenosine is produced as a hydrolysis product. (adxs.org)
- γδ T cells express unique T cell receptor (TCR) γ and TCR δ chains, with structural and functional heterogeneity. (explorationpub.com)
Asthma3
- Inhaled formoterol works like other beta2-agonists, causing bronchodilatation through relaxation of the smooth muscle in the airway so as to treat the exacerbation of asthma. (pharmfair.com)
- Not indicated for asthma that can be successfully managed with occasional use of an inhaled, short-acting beta2-adrenergic agonist. (pharmfair.com)
- The inventors found that GLP-1R agonists inhibited IL-33 expression and release from the lungs of mice in response to an airway challenge the allergen extract of the aeroallergen Alternaria alternata , an aeroallergen which has protease activity and which is associated with severe asthma exacerbations. (justia.com)
Interaction1
- Unlike the mGluR-kainate interaction, which required a pretreatment with an mGluR agonist and was insensitive to pertussis toxin (PTx), the mGluR modulation of 5HT actions was rapid and was blocked by PTx. (jneurosci.org)
Cells4
- The expression of SUR2B in dermal papilla cells might play a role in the production of adenosine. (wikipedia.org)
- Adenosine is found in almost all body cells. (adxs.org)
- For instance, GLP-1R agonist administration decreased TNFα and IL-6 production by peripheral blood mononuclear cells (PBMC) of obese patients with T2D and diabetic mouse adipose tissue. (justia.com)
- With this review, we provide an overview on histamine and the expression of its four receptors on skin resident and nonresident cells. (springeropen.com)
Amino1
- Purification and N-terminal amino acid sequence of the Ah receptor from the C57BL/6J mouse. (aspetjournals.org)
Type1
- GLP-1 receptor (GLP-1R) agonists, such as liraglutide and exenatide are approved by the Food and Drug Administration (FDA) for treatment of type 2 diabetes (T2D). (justia.com)
Structural1
- However, despite growing biological and clinical significance, little is known about the structural arrangement of this receptor or any of its family members. (uci.edu)
Demonstrate1
- In this study, we demonstrate that the 41-aa cleaved peptide, TR1-41 (MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR) is a strong platelet agonist. (umassmed.edu)
Express1
- MCs express receptors for both estrogen and progesterone that induce degranulation upon binding. (frontiersin.org)
Signal1
- The effect of minoxidil is mediated by adenosine, which triggers intracellular signal transduction via both adenosine A1 receptors and two sub-types of adenosine A2 receptors (A2A and A2B receptors). (wikipedia.org)
Data1
- Development of the A2 locus, acquisition of the recapitulate units and the ability to visceralize would then require occurred following divergence of the L. For example, data obtained from patients with epilepsy establish that GABA convey is in general preserved (Mathern et al. (wgc2010.sk)
Production1
- By binding iron in a Fenton-reactive form, intracellular hydroxyl radical production would ensue, but hydroxyl would be immediately trapped and scavenged by the minoxidil to generate a nitroxyl radical. (wikipedia.org)
Structure1
- The cryo-EM structure of the endocytic receptor DEC-205. (uci.edu)