Glycoprotein activity platelet function tests. Medical search. Frequent questions

The ristocetin-induced platelet aggregation (RIPA) is an ex vivo assay for live platelet function. (wikipedia.org)
It measures platelet aggregation with the help of von Willebrand factor (vWF) and exogenous antibiotic ristocetin added in a graded fashion. (wikipedia.org)
citation needed] In an unknown fashion, the antibiotic ristocetin causes von Willebrand factor to bind the platelet receptor glycoprotein Ib (GpIb), so when ristocetin is added to normal blood, it causes agglutination of fixed platelets or initiates the initial agglutination phase of aggregation of live platelets. (wikipedia.org)
The method output includes levels of forward and side scatter, levels of major adhesion and aggregation glycoproteins Ib and IIb-IIIa, active integrins' level based on PAC-1 binding, major alpha-granule component P-selectin, dense granule function based on mepacrine uptake and release, and procoagulant activity quantified as a percentage of annexin V-positive platelets. (nih.gov)
Platelet aggregation testing often requires a coagulation consult with a pathologist prior to scheduling specimen collection. (unboundmedicine.com)
Functional platelet disorders affect the adhesion, activation, or aggregation of platelets and are frequently associated with excessive bleeding, often following trauma or surgery. (arupconsult.com)
further testing may include platelet aggregation tests, platelet flow cytometry, and in some cases, genetic testing. (arupconsult.com)
Bernard-Soulier syndrome (an adhesion disorder) and Glanzmann thrombasthenia (an aggregation disorder) are among the most well-recognized inherited disorders of platelet function and are severe clinical conditions. (arupconsult.com)
The platelet GP IIb/IIIa complex mediates platelet-to-platelet interactions (platelet aggregation). (medscape.com)
The platelet glycoprotein VI (GPVI) is a platelet membrane protein that participates in platelet adhesion and aggregation. (duke.edu)
The primary endpoint was assessment of platelet aggregation after stimulation with adenosine diphosphate 20 μM at 12-month follow-up. (revespcardiol.org)
TR1-41 induces platelet aggregation. (umassmed.edu)
BACKGROUND: Studies have been performed on human fresh, liquid-preserved, and cryopreserved platelets (PLTs) to assess PLT-adhesive surface receptors, PLT membrane procoagulant activity, PLT aggregation, and thromboxane production. (umassmed.edu)
STUDY DESIGN AND METHODS: In both human and baboon fresh and lyophilized PLTs, aggregation response and PLT production of thromboxane A2 were measured after stimulation, and PLT surface markers P-selectin, glycoprotein (GP) Ib, GPIIb-IIIa, and factor (F) V were measured before and after stimulation. (umassmed.edu)
However, diabetic patients have significantly higher platelet aggregation and activation than non-diabetic patients, including those undergoing dual antiplatelet therapy [ 4 - 6 ]. (aging-us.com)
However, the ultimate common pathway of platelet aggregation is the activation of glycoprotein (GP) IIb/IIIa receptors present on platelet surface [ 7 - 9 ]. (aging-us.com)
Bitiscetin has recently been shown to induce von Willebrand factor (vWF)-dependent aggregation of fixed platelets (Hamako J, et al, Biochem Biophys Res Commun 226:273, 1996). (ashpublications.org)

Under physiological circumstances, the resistance of the endothelial cell lining to interactions with platelets and coagulation factors prevents thrombosis. (medscape.com)
Results Our findings indicate that the platelets in HD are dysfunctional with respect to the release of angiogenic factors and functions including thrombosis, angiogenesis and vascular haemostasis. (bmj.com)
In thrombosis, platelet activation serves as the initiation factor. (aging-us.com)

The workup of a patient with a platelet-type bleeding pattern typically includes correlation with platelet count ( thrombocytopenia ), evaluation of platelet morphology on peripheral smear, exclusion of acquired causes of platelet dysfunction, and testing for von Willebrand disease (VWD) . (arupconsult.com)
Testing is also warranted in infants and children with unexplained thrombocytopenia . (arupconsult.com)
Flow cytometry can also be used in the following clinical settings: monitoring of GPIIb-IIIa antagonist therapy, diagnosis of inherited deficiencies of platelet surface glycoproteins, diagnosis of storage pool disease, diagnosis of heparin-induced thrombocytopenia, and measurement of the rate of thrombopoiesis. (umassmed.edu)
The platelet count is normally 140,000 to 440,000/mcL (140 to 440 × 10 9 /L). However, the count can vary slightly according to menstrual cycle phase, decrease during near-term pregnancy (gestational thrombocytopenia), and increase in response to inflammatory cytokines (secondary, or reactive, thrombocytosis). (msdmanuals.com)

On resting platelets, GP IIb/IIIa is unable to bind fibrinogen or vWf. (medscape.com)
In addition, they release various activating substances, such as thromboxane A2 and adenosine diphosphate or ADP, to activate other platelets and make them express a new surface receptor called glycoprotein IIb/IIIa or GPIIb/IIIa. (osmosis.org)
and glycoprotein IIb/IIIa inhibitors like abciximab , tirofiban , and eptifibatide . (osmosis.org)
Qin R , Zhu H , Wang F , Song M , Lin P , Xing Y , Zhang W , Zhong M , Wang Z , . Platelet activation in diabetic mice models: the role of vascular endothelial cell-derived protein disulfide isomerase-mediated GP IIb/IIIa receptor activation. (aging-us.com)
The EMP-PDI content and GP IIb/IIIa expression of mice platelets were determined. (aging-us.com)
Compared with the normal diet group, the diabetic group had significantly increased plasma EMP-PDI content and accelerated platelet activation by increased GP IIb/IIIa expression. (aging-us.com)
In conclusion, EMP-PDI promotes early platelet activation through glycoprotein (GP) IIb/IIIa receptors present on platelet surface in the diabetic state. (aging-us.com)

These receptors help platelets bind to circulating proteins called fibrinogen, which helps link various platelets together. (osmosis.org)
In this mechanism, vWF acts as a molecular bridge between constituents of the subendothelium, like collagen, and receptors of the platelet membrane, primarily the GPIb. (ashpublications.org)

Platelets play a primary role in this process, interacting with subendothelium-bound von Willebrand factor (vWf) via the membrane glycoprotein (GP) Ib complex. (medscape.com)

It is similar to the ristocetin cofactor assay but has the added benefit in that it helps in the diagnosis of type 2B/pseudo von Willebrand disease (vWD) and Bernard-Soulier syndrome because it uses patient's live endogenous platelets, whereas ristocetin cofactor assay tests the function of only the vWF and not the platelets. (wikipedia.org)
Von Willebrand Disease Von Willebrand disease (VWD) is a hereditary quantitative deficiency or functional abnormality of von Willebrand factor (VWF), which causes platelet dysfunction. (msdmanuals.com)
V ON WILLEBRAND FACTOR (vWF) is a multimeric glycoprotein (GP) that plays a key role, under high-shear conditions, in the initial attachment of platelets to the extracellular matrix of the endothelial cells after injury of the vessel wall. (ashpublications.org)

Now, antiplatelet medications act by preventing the activation of platelets to form a blood clot. (osmosis.org)
Attachment of integrin αIIbβ3 from adjacent platelets to the same fibrinogen protein helps platelets cluster together (platelet cohesion) to form a blood clot. (medlineplus.gov)

Platelet activation allows binding of these proteins, which bridges adjacent platelets. (medscape.com)

Intensive glucose control with insulin in patients with an acute coronary syndrome reduces platelet reactivity during hospitalization, compared to conventional control. (revespcardiol.org)
However, the effect of strict, long-term glucose control on platelet reactivity in these patients remains uncertain. (revespcardiol.org)
180 mg/dL), on platelet reactivity after hospital discharge in patients with an acute coronary syndrome and hyperglycemia. (revespcardiol.org)
Flow cytometry can be used to measure platelet reactivity, circulating activated platelets, platelet-platelet aggregates, leukocyte-platelet aggregates, procoagulant platelet-derived microparticles, and calcium flux. (umassmed.edu)
Follow-up testing of these patients is recommended in 3-6 months to confirm reactivity. (diapharma.com)

Ristocetin cofactor assay uses the patient's platelet poor plasma (with vWF but no platelets) and adds ristocetin and exogenous formalin-fixed platelets which can passively agglutinate (but not actively aggregate, as they are dead). (wikipedia.org)
The aptamers were tested in a platelet functionality assay (PFA-100) which measures time until platelet plug formation in vitro . (duke.edu)
A definitive diagnosis depends upon the prothrombin (functional activity) assay or the prothrombin level antigenic concentration. (labpedia.net)
The mixed lymphocyte reaction (MLR) assay was used to evaluate the function of DCs. (frontiersin.org)

Background: Blood bank-stored human platelets are one of the life-saving transfusion products to prevent bleeding in multiple clinical settings. (eurekaselect.com)
Apoptotic activity in stored human platelets. (eurekaselect.com)
From the identified 2938 proteins and 7503 unique peptides, we characterized N-terminal methionine excision, co- and posttranslational Nα acetylation, protein maturation, and proteolytic processing of proteins in human platelets. (ashpublications.org)

When platelets attach to the same fibrinogen protein, they are linked together. (osmosis.org)

Conventional units.MPV = mean platelet volume.Care must be taken when reviewing platelet counts after a blood product transfusion-documentation should clearly reflect the time and date of the last transfusion with respect to the collection time of the study. (unboundmedicine.com)
Proteases, and specifically metalloproteinases, have been linked to the loss of platelet function during storage before transfusion, but the underlying mechanisms remain unknown. (ashpublications.org)

Integrin αIIbβ3 can also bind other proteins on platelets and in the blood as well as proteins within the intricate lattice that forms in the space between cells (extracellular matrix) to ensure proper clot formation and promote wound healing. (medlineplus.gov)
This abnormally active protein is unable to reach the surface of the platelet where it is needed to bind to other platelets during clot formation. (medlineplus.gov)
Its ability to bind two Fe +3 ions with high affinity, in cooperation with two HCO 3 - ions, contributes to its major structure-functional properties, including antimicrobial activity. (ift.org)
Thus, our data support the hypothesis that an interaction between the A1 and A3 domains exists that may play a role in the function of vWF by regulating the ability of the A1 domain to bind to platelet GPIb. (ashpublications.org)

This initial interaction (platelet adhesion) sets the stage for other adhesive reactions that allow the platelets to interact with other agonists in the vicinity of vessel injury, such as adenosine 5'-diphosphate (ADP), subendothelial collagen, and thrombin. (medscape.com)

The ability of platelets to carry out their hemostatic function can be impaired in a wide range of inherited and acquired conditions: trauma, surgery, inflammation, pre-term birth, sepsis, hematological malignancies, solid tumors, chemotherapy, autoimmune disorders, and many others. (nih.gov)
The hemostatic system consists of platelets, coagulation factors, and the endothelial cells lining the blood vessels. (medscape.com)
The alpha granules contain hemostatic proteins such as fibrinogen, vWf, and growth factors (eg, platelet-derived growth factor and transforming growth factors). (medscape.com)
Once activated, platelets have two major mechanisms to recruit additional platelets to the growing hemostatic plug. (medscape.com)
Thus, the release reaction and prostaglandin synthesis act to consolidate the initial hemostatic plug by promoting the participation of other platelets in the growing hemostatic plug. (medscape.com)
The initial hemostatic plug, composed primarily of platelets, is stabilized further by a fibrin mesh generated in secondary hemostasis. (medscape.com)
Of particular concern is hepatocyte-dependent vitamin K carboxylation of FII, FVII, FIX, FX, protein C, and protein S. Vitamin K activation of the dependent coagulation and anticoagulant proteins orchestrates carboxylation of glutamic acid residues, needed for reaction with calcium required for their hemostatic activity. (msdvetmanual.com)
Any of these conditions, even those in which platelets are markedly increased, may cause defective formation of hemostatic plugs and bleeding. (msdmanuals.com)

cite journal}}: CS1 maint: multiple names: authors list (link) Pham A, Wang J. Bernard-Soulier syndrome: an inherited platelet disorder. (wikipedia.org)

Circulating monocyte-platelet aggregates appear to be a more sensitive marker of in vivo platelet activation than circulating P-selectin-positive platelets. (umassmed.edu)
In ex vivo storage, platelets undergo apoptosis and it is highly desirable to prevent this process to preserve platelet quality. (eurekaselect.com)
In vivo, plasma vWF has no affinity for platelet GPIb. (ashpublications.org)

Integrin beta 3 (ITGB3) glycoprotein plays multiple roles in platelet physiological processes, and it was reported in other cell types that downregulation of ITGB3 induces apoptosis. (eurekaselect.com)
The ITGB3 gene provides instructions for making the beta3 subunit of a receptor protein called integrin alphaIIb/beta3 (αIIbβ3), which is found on the surface of small cells called platelets. (medlineplus.gov)
It is estimated that 80,000 to 100,000 copies of integrin αIIbβ3 are present on the surface of each platelet. (medlineplus.gov)
The mutations that cause this disorder occur in both copies of the gene in each cell and impair the production or activity of the beta3 subunit, which disrupts the formation of functional integrin αIIbβ3. (medlineplus.gov)
The overactive integrin αIIbβ3 binds inappropriately to clotting proteins within the cell during the formation of platelets, causing the platelets to become misshapen and large. (medlineplus.gov)
Because the mutation that causes this disorder affects only one copy of the ITGB3 gene, some normal integrin is formed and normal platelets produced, which accounts for the mild signs and symptoms in affected individuals. (medlineplus.gov)

How do functional platelet disorders manifest clinically? (arupconsult.com)
The clinical features of functional platelet disorders vary. (arupconsult.com)
rarely, it may be observed in functional platelet disorders). (arupconsult.com)
Functional platelet disorders are generally associated with immediate bleeding in response to surgery or trauma, whereas factor deficiencies are associated with delayed bleeding. (arupconsult.com)
What are some causes of acquired functional platelet disorders? (arupconsult.com)
Which functional platelet disorders are inherited? (arupconsult.com)
Refer to the table, Laboratory Findings in Selected Inherited Functional Platelet Disorders , for additional information and a more comprehensive list of inherited functional platelet disorders. (arupconsult.com)
Laboratory testing for functional platelet disorders is appropriate in individuals with bleeding manifestations that suggest a functional platelet disorder (eg, easy bruising, prolonged bleeding following dental work or surgery, menorrhagia), particularly those with a family history of a bleeding disorder and in whom VWD has been previously excluded. (arupconsult.com)
Platelet disorders lead to defects in primary hemostasis and produce signs and symptoms different from coagulation factor deficiencies (disorders of secondary hemostasis). (medscape.com)

Storage-stable glycoprotein blood coagulation factor that can be activated to factor Xa by both the intrinsic and extrinsic pathways. (lookformedical.com)
Its activated form, IXa, forms a complex with factor VIII and calcium on platelet factor 3 to activate factor X to Xa. (lookformedical.com)
FACTOR VII is a Vitamin K dependent glycoprotein essential to the extrinsic pathway of coagulation. (lookformedical.com)
Ardissino DMerlini PAAriens RCoppola RBramucci EMannucci PM Tissue-factor antigen and activity in human coronary atherosclerotic plaques. (jamanetwork.com)
Endothelial cells secrete platelet-derived growth factor (PDGF)-BB and recruit PDGF receptor beta (PDGFRbeta)-overexpressing pericytes, which in turn cover and stabilize neovessels, independent of vascular endothelial growth factor (VEGF). (stanford.edu)

The binding of vWF to platelets involves glycoprotein (GP) Ib because it was totally blocked by monoclonal antibody (MoAb) 6D1 directed towards the vWF-binding site of GPIb. (ashpublications.org)
The binding also involves the GPIb-binding site of vWF located on the A1 domain because it was inhibited by MoAb to vWF whose epitopes are within this domain and that block binding of vWF to platelets induced by ristocetin or botrocetin. (ashpublications.org)

Formalin does not allow the extrinsic platelets to secrete the vWF of their α-granules, and thus only the activity of the intrinsic vWF is tested. (wikipedia.org)

platelet function testing is used to assist in identification of inherited or acquired platelet dysfunction or to evaluate therapeutic response to platelet-inhibiting drugs. (unboundmedicine.com)
Endothelial dysfunction refers to a condition whereby the inner linings of the endothelium fail to function properly. (smartacademicwriting.com)

Furthermore, the inventors engineered inactivating aptamers that control GPVI aptamer activity, making it possible to fine-tune the clinical effect in patients. (duke.edu)
Clinical applications of whole blood flow cytometric assays of platelet function in disease states (e.g., acute coronary syndromes, angioplasty, and stroke) may include identification of patients who would benefit from additional antiplatelet therapy and prediction of ischemic events. (umassmed.edu)
What is the clinical significance when samples test positive for the anti-cardiolipin antibodies and are negative for anti-b2GPI? (diapharma.com)
Through the ACE I developed and participated in numerous clinical trials, testing novel treatments for systemic autoimmune diseases. (rochester.edu)
Therapeutic agents inhibiting PDGF-BB/PDGFRbeta signaling were tested in clinical trials but failed to provide additional benefits over anti-VEGF agents. (stanford.edu)
To obtain an independent test set, the remaining 11 of the 58 tumors were selected from an ongoing clinical trial and used here as a blinded sion via ER,3 however the details of the estrogen effect on down- test set. (lu.se)

Normal, abnormal, or various combinations of core lab study results can indicate that all is well, reveal a problem that requires further investigation with additional testing, signal a positive response to treatment, or suggest that the health status is as expected for the associated situation and time frame. (unboundmedicine.com)
The screening test is used to identify abnormal bleeding tendency. (unboundmedicine.com)
Platelet surface glycoprotein expression = Normal (Some laboratories report Greater Than or Equal to 70.0%) Abnormal findings may be supplemented with an interpretation by a pathologist. (unboundmedicine.com)
aspirin and nonsteroidal anti-inflammatory drugs (NSAIDs) are common causes of abnormal platelet function, and platelet function testing may need to be deferred if patients have been taking these medications. (arupconsult.com)

Thrombospondins are multimeric multidomain glycoproteins that function at cell surfaces and in the extracellular matrix milieu. (embl.de)

TAILS proteomics identified 2938 human platelet proteins, pervasive proteolytic processing, and precise proteolytic cleavage sites in stored platelets. (ashpublications.org)
Regarding function of these uremia-specific proteins, only SAA mimicked ESRD-HDL by promoting inflammatory cytokine production. (lww.com)
The process of sulfation also affects the functioning of peptides and proteins. (simplymimi.net)

Platelets are the key prothrombotic element, forming aggregates that lead to blood clots. (duke.edu)

However, current agents pose a significant risk to patients as they increase the risk of bleeding, especially in high-risk surgery, and have no antidote to rapidly reverse function. (duke.edu)
Methods We assessed the functional status of platelets by performing ELISA, western blot and RNA sequencing in a cohort of 71 patients and 68 age- and sex-matched healthy control subjects. (bmj.com)
In conclusion, HDL has anti-inflammatory activities that are defective in uremic patients as a result of specific changes in its molecular composition. (lww.com)
10 , 11 Dyslipidemia in ESRD patients is characterized by a dysregulation of the synthesis and activity of HDL, leading to decreased plasma levels of HDL cholesterol (HDL-C). 10 Many epidemiologic studies have documented an inverse relationship between HDL-C levels and the progression of atherosclerosis and increased risk of cardiovascular disease in the general population. (lww.com)
Failure of a major pathway such as sulfation will lead to a neurotransmitter imbalance and this can have effects on behavior, mood and function, as can be seen in migraine where many patients have reduced sulfation capacity. (simplymimi.net)
In patients whose symptoms and condition have become stable after initial treatment, this assessment should include stress testing. (bmj.com)
lncRNAs and mRNAs in the NP group (DCs isolated from NP) and the test group (DCs isolated from patients with AR) were identified via chip technology and bioinformatic analyses. (frontiersin.org)
Testing for specific mutations in these patients helps to determine the decision on the duration of anticoagulant therapy, risk stratification for primary or secondary prophylaxis. (intechopen.com)
HA627 trade name] is not suitable for treating all other ART-experienced patients or when HIV-1 genotype testing is not available. (who.int)

It is important to rule out acquired conditions during an evaluation for a functional platelet disorder. (arupconsult.com)
Initial laboratory testing for a functional platelet disorder includes a CBC with platelet count and a peripheral smear. (arupconsult.com)
previously called a myeloproliferative disorder) involving overproduction of platelets because of a clonal abnormality of a hematopoietic stem cell. (msdmanuals.com)
is platelet overproduction in response to another disorder. (msdmanuals.com)
Mutations in the ITGB3 gene can also cause another rare bleeding disorder called platelet-type bleeding disorder 16. (medlineplus.gov)
Any disorder where there is an abnormally low amount of platelets. (pennutrition.com)

These cationic peptides can also be generated by enzymatic activity (Tomita et al. (ift.org)

The platelets arise from the fragmentation of the cytoplasm of megakaryocytes in the bone marrow and circulate in blood as disc-shaped anucleate particles for 7-10 days. (medscape.com)
Platelets circulate for 7 to 10 days. (msdmanuals.com)
Platelets circulate in blood and are an essential component of blood clots. (medlineplus.gov)

The abnormally shaped platelets have a shortened lifespan, so platelet numbers are often reduced, which impairs clot formation. (medlineplus.gov)

The sympathetic nervous system regulates this function through β-adrenergic stimulation of brown mature adipocytes' dissipation of energy in the form of heat mediated by mitochondrial uncoupling protein-1 (UCP-1) activation. (springer.com)
Ectopic expression of miR-103b decreased the luciferase reporter activity in HeLa cells and decreased ITGB3 mRNA and protein levels in platelets, concomitant with an increase in apoptosis. (eurekaselect.com)
The purpose of this study was to investigate the release of Endothelial microparticle (EMP)-associated protein disulfide isomerase (PDI) after endothelial cell injury induced in diabetes and the changes in platelet activation. (aging-us.com)
System-wide identification of metalloproteinase and other proteinase substrates and their respective cleavage sites suggests novel mechanisms of the effect of proteases on protein activity and platelet function during storage. (ashpublications.org)
IMPORTANCE The trimeric glycoprotein Env, the only viral protein expressed on the surface of HIV-1, is the target of broadly neutralizing antibodies and the focus of most vaccine development efforts. (stanford.edu)

Final validation of the functional role of miR-103b in ITGB3 downregulation and resulting induction of apoptosis was assessed in stored platelets by FACS analysis following ectopic expression of miR-103b. (eurekaselect.com)
Moreover, bioinformatic analyses were employed to identify the related biological functions of monocyte-derived DCs and construct the functional networks of lncRNAs and mRNAs that are differentially expressed (DE) in imDCs and mDCs. (frontiersin.org)

Thrombopoietin helps control the number of circulating platelets by stimulating the bone marrow to produce megakaryocytes, which in turn shed platelets from their cytoplasm. (msdmanuals.com)
Thrombopoietin is produced in the liver at a constant rate and its circulating level is determined by how much is bound to circulating platelets and possibly to bone marrow megakaryocytes and the extent to which circulating platelets are cleared. (msdmanuals.com)

Physicians should interpret the results of the APS tests in light of the patient's history, physical findings, and other diagnostic procedures. (diapharma.com)

flow cytometry for evaluation of surface glycoprotein expression. (unboundmedicine.com)
Platelet function in whole blood can be comprehensively evaluated by flow cytometry. (umassmed.edu)
Flow cytometry was used to determine the immune regulatory function of immature DCs (imDCs) and mature DCs (mDCs). (frontiersin.org)
We tested whether an antibody-drug conjugate (ADC) - an engineered monoclonal antibody linked to a cytotoxic agent - could selectively ablate pericytes and suppress retinal and choroidal neovascularization.Methods: Immunoblotting, flow cytometry, cell viability test, and confocal microscopy were conducted to assess the internalization and cytotoxic effect of ADC targeting mPDGFRbeta in an in vitro setting. (stanford.edu)
Other established methods, such as flow cytometry, can then provide extra data regarding immune cell phenotype, activation, and function. (technologynetworks.com)

In Dentistry autogenous bone is the most useful tissue used in pre-prosthetic surgery and rehabilitation treatment of bone defects, thereby contributing to the function and aesthetics 8 . (bvsalud.org)

Platelets are eventually destroyed by apoptosis, a process independent of the spleen. (msdmanuals.com)
However, underlying mechanisms of apoptosis are not well understood in stored platelets. (eurekaselect.com)
However, whether miR-103b can target and downregulate ITGB3 in stored platelets and such miRNA regulation promotes apoptosis is not known. (eurekaselect.com)
Objective: Our objective of this study is to validate the abundance of miR-103b in stored platelets and identify whether ITGB3 is a target of miR-103b for the downregulation and this interaction promotes apoptosis. (eurekaselect.com)
Conclusion: The results demonstrate that in stored platelets, miR-103b is highly expressed and can interact with and downregulate ITGB3 and promote apoptosis in stored platelets. (eurekaselect.com)
Leytin V. Apoptosis in the anucleate platelet. (eurekaselect.com)

These results provided possible molecular mechanisms of monocyte-derived DCs in the immunoregulating function and laid the foundation for the molecular therapeutic targets of AR. (frontiersin.org)

These interactions further activate platelets. (medscape.com)

Here, we summarise the mechanisms contributing to adipose tissue (AT) plasticity and function including characteristics and cellular complexity of the various adipose depots and we discuss recent insights into AT origins, identification of adipose precursors, pathophysiological regulation of adipogenesis and its relation to WAT/BAT expandability in obesity and its associated comorbidities. (springer.com)
In this paper, we present candidates for a multifaceted approach to the management of COVID-19, based on repurposing tried and tested, affordable, widely available drugs with proven long-term safety, and mechanisms of action that address the underlying pathophysiology of the disease. (jmir.org)

Platelet count is part of a CBC, one of the most requested laboratory studies, and is included in the Anemia profile, Complete Blood Count, General Health panel, and Obstetric panel. (unboundmedicine.com)
Bone marrow is the place for the production of the hematopoietic cells which differentiate in to three groups: red blood cells, white blood cells and platelets. (longdom.org)
Overview of Myeloproliferative Neoplasms Myeloproliferative neoplasms are clonal proliferations of bone marrow stem cells, which can manifest as an increased number of platelets, red blood cells (RBCs), or white blood cells (WBCs). (msdmanuals.com)
Objectives Seeking to elucidate the origin of these vascular and BBB abnormalities, we studied platelets that are known to play a role in maintaining the integrity of the vasculature and thrombotic pathways linked to this, given they surprisingly contain the highest concentration of mHtt of all blood cells. (bmj.com)
We used a dedicated N-terminomics technique, iTRAQ terminal amine isotopic labeling of substrates (TAILS), to characterize the human platelet N-terminome, proteome, and posttranslational modifications throughout platelet storage over 9 days under blood-banking conditions. (ashpublications.org)
Fibrin and platelets form the blood clot to stop the bleeding. (labpedia.net)
Prothrombin is a glycoprotein with a molecular weight of 71,600 daltons in the blood and plasma. (labpedia.net)
The reverse situation is also recognized: people with gain-of-function PCSK9 mutations have a marked increase in blood cholesterol levels and an increased coronary heart disease incidence. (fatsoflife.com)
Remember, the endothelium plays an important role in regulating blood clotting but this function is likely to be affected by several conditions including metabolic syndrome, hypertension, smoking and inactivity. (smartacademicwriting.com)

This analysis is performed for both resting and dual-agonist-stimulated platelets. (nih.gov)
In this study, we demonstrate that the 41-aa cleaved peptide, TR1-41 (MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR) is a strong platelet agonist. (umassmed.edu)
In summary, the cleaved peptide of the seven-transmembrane domain TR (TR1-41) is a strong platelet agonist. (umassmed.edu)

Studies on the mechanism of ristocetin-induced platelet adhesion. (wikipedia.org)

The body's reaction to vessel wall injury is rapid adhesion of platelets to the subendothelium. (medscape.com)

We have purified bitiscetin from Bitis arietans venom and investigated the mechanism whereby it promotes a form of vWF that is reactive with platelets. (ashpublications.org)

In some cases a decline in procoagulant activity is adjusted against a decline in anticoagulant activity, achieving copacetic changes. (msdvetmanual.com)

Common signs and symptoms may stem from decreased hepatic synthetic function (eg, coagulopathy), portal hypertension (eg, variceal bleeding), or decreased detoxification capabilities of the liver (eg, hepatic encephalopathy). (medscape.com)

Conclusion Taken together, our results provide a better understanding for the impact of mHtt on platelet function. (bmj.com)

This suggests that the mechanism of platelet activation in the diabetic state has not been fully elucidated. (aging-us.com)
Laboratory tests for evaluating the individual's clotting mechanism. (lookformedical.com)

Properdin is a serum glycoprotein that up-regulates the alternative pathway of complement by stabilizing the C3b-Bb complex. (embl.de)

Thyroid stimulating hormone (TSH) is a glycoprotein hormone produced by the anterior lobe of the hypophysis that stimulates the growth and function of the thyroid gland. (pennutrition.com)

In the presence of bitiscetin, vWF binds to platelets in a dose-dependent and saturable manner. (ashpublications.org)

The localization of the binding site of bitiscetin within the A3 domain was further supported by showing that MoAb to vWF, which are specific for this domain and block the interaction between vWF and collagen, are potent inhibitors of the binding of bitiscetin to vWF and consequently of the bitiscetin-induced binding of vWF to platelets. (ashpublications.org)

Les numérations plaquettaire et leucocytaire ainsi que la concentration en cytokines (IL-2R, IL-8 et TNF-) ont été me- surées. (who.int)
WBC) and proinflammatory cytokines in All PCs were obtained from healthy volc the supernatant of platelet concentrates unteer donors by apheresis (CSc3000 Plus, [ 4,5 ]. (who.int)

Anatomy2

Diseases5

Chemicals and Drugs30

Analytical, Diagnostic and Therapeutic Techniques and Equipment11

Phenomena and Processes10

Information Science2

Aggregation17

Thrombosis3

Thrombocytopenia4

IIIa7

Receptors2

Membrane glycoprotein1

Willebrand3

Form a blood clot2

Adjacent platelets1

Reactivity5

Assay4

Human platelets3

Fibrinogen protein1

Transfusion2

Bind4

Thrombin1

Hemostatic8

Bernard-Soulier1

Vivo3

Integrin6

Disorders9

Factor5

GpIb2

Secrete1

Dysfunction2

Clinical6

Abnormal4

Multimeric1

Proteins3

Forming aggregates1

Patients9

Disorder6

Peptides1

Circulate3

Abnormally1

Protein5

Functional2

Thrombopoietin2

Patient's1

Flow5

Defects1

Apoptosis6

Therapeutic1

Activate1

Mechanisms2

Blood9

Agonist3

Ristocetin1

Subendothelium1

Reactive1

Procoagulant activity1

Hepatic1

Conclusion1

Mechanism2

Serum1

Stimulates1

Binds1

Interaction1

Cytokines2