At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. (wikipedia.org)
7. GRB2 links signaling to actin assembly by enhancing interaction of neural Wiskott-Aldrich syndrome protein (N-WASp) with actin-related protein (ARP2/3) complex. (nih.gov)
8. N-WASP, a novel actin-depolymerizing protein, regulates the cortical cytoskeletal rearrangement in a PIP2-dependent manner downstream of tyrosine kinases. (nih.gov)
12. Wiskott-Aldrich syndrome protein is associated with the adapter protein Grb2 and the epidermal growth factor receptor in living cells. (nih.gov)
19. The uncovering of a novel regulatory mechanism for PLD2: formation of a ternary complex with protein tyrosine phosphatase PTP1B and growth factor receptor-bound protein GRB2. (nih.gov)
It is known that the human Ras GTPase activating protein (GAP) p120-GAP can be phosphorylated by different members of the Src kinase family and recently phosphorylation of the GDP/GTP exchange factor (GEF) CDC25Mm/GRF1 by proteins of the Src kinase family has been revealed in vivo [Kiyono, M., Kaziro, Y. & Satoh, T. (2000) J. Biol. (embl.de)
A mouse homologue of the Drosophila tumor suppressor l(2)tid gene defines a novel Ras GTPase-activating protein (RasGAP)-binding protein. (embl.de)
Here we report the cloning and characterization of a novel GAP-binding protein, mTid-1, a DnaJ chaperone protein that represents the murine homolog of the Drosophila tumor suppressor l(2)tid gene. (embl.de)
Using pull-down assay and mass spectroscopy we identified the actin-related protein, Arp3, as a novel interacting protein of RasGRP3. (oncotarget.com)
In summary, RasGRP3 acts as an important integrating signaling protein of the DAG and Ras signaling pathways and actin polymerization and represents an important therapeutic target in GBM. (oncotarget.com)
For example the guanine nucleotide exchange factor Sos binds to Grb2 which in turn interacts with the Ras protein. (ecologicalsgardens.com)
Normally Ras is bound to GDP because of the abundance of GTPase-activating protein and neurofibromin which both suppress Ras function. (ecologicalsgardens.com)
The small guanosine triphosphate (GTP)-binding protein ADP-ribosylation factor (ARF) 6 regulates membrane recycling to regions of plasma membrane remodeling via the endocytic pathway. (silverchair.com)
Has a critical role in the stimulation of the CDK20/MAPK3 mitogen-activated protein kinase cascade by epidermal growth factor. (drugbank.com)
Ras and Rab interactor 1 (RIN1), located at chromo- some 11q13.2, was first isolated as an RAS effector that directly interacts with active Ras.6 A subsequent analysis of full-length RIN1 clones showed that the protein product of this gene binds with high affinity and high specificity to activated HRAS.6 Recent studies have demonstrated that RIN1 plays an important role in mediating signal transduc- tion. (malt1inhibitor.com)
and phosphoinositide (PI) 3′-kinase and Ral-guanine nucleotide dissociation stimulator (Ral-GDS) which activate lipid pathways (2). (ecologicalsgardens.com)
Exocyst complex1
Here, we show that GTP-bound ARF6 interacts with Sec10, a subunit of the exocyst complex involved in docking of vesicles with the plasma membrane. (silverchair.com)
GRB21
Ligand binding induces the dimerization of receptor subunits marketing autophosphorylation from the receptor and recruiting a number of intracellular docking proteins (such as for example Grb2 Shc and Nck) towards the plasma membrane. (ecologicalsgardens.com)
Pathways2
Signaling pathways are initiated using the binding of the ligand such as for example PDGF EGF EGF-like ligands (e.g. (ecologicalsgardens.com)
In addition to active Ras proteins, several interac- tion partners have been identified, including Rab5,7 ABL tyrosine kinases,8 signal-transducing adapter molecule,9 epidermal growth factor receptor (EGFR),10 and 14-3-3 proteins.11 Two downstream RIN1 effector pathways have been described. (malt1inhibitor.com)
Proteins6
Ras proteins are membrane-associated molecular switches that bind GTP and GDP and slowly hydrolyze GTP to GDP [ ( PUBMED:1898771 ) ] in fundamental events such as signal transduction, cytoskeleton dynamics and intracellular trafficking. (embl.de)
GEFs, GAPs, GDIs and effectors: taking a closer (3D) look at the regulation of Ras-related GTP-binding proteins. (embl.de)
In addition to its association with Ras, GAP has been shown to bind to several tyrosine-phosphorylated proteins in cells stimulated by growth factors or expressing transforming tyrosine kinase variants. (embl.de)
The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. (nih.gov)
SRC is implicated in regulation of pre-mRNA-processing and phosphorylates RNA-binding proteins such as KHDRBS1. (drugbank.com)
Regulates1
Interleukin-21 (IL-21) is a pleiotropic cytokine that induces expression of transcription factor BLIMP1 (encoded by Prdm1), which regulates plasma cell differentiation and T cell homeostasis. (gsea-msigdb.org)
Elucidation1
15. The elucidation of novel SH2 binding sites on PLD2. (nih.gov)
Interacts1
20. Actin directly interacts with phospholipase D, inhibiting its activity. (nih.gov)
Kinases3
Differential actions of p60c-Src and Lck kinases on the Ras regulators p120-GAP and GDP/GTP exchange factor CDC25Mm. (embl.de)
P61959.1 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY 1367453_at NP_446195 8.92 hsp90 co-chaperone Cdc37 Cdc37 Rattus norvegicus " Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity. (nih.gov)
First binding of trastuzumab is usually associated with upregulation of the p27Kip inhibitor of some cyclin-dependent kinases. (ecologicalsgardens.com)
Membrane2
Ras serves as a molecular switch in the plasma membrane that alternates between an inactive GDP-bound state and an active GTP-bound state. (ecologicalsgardens.com)
However upon recruitment of Sos to the 4-Methylumbelliferone membrane Sos binds Ras-GDP and facilitates release of GDP. (ecologicalsgardens.com)
GTPase1
10. Phospholipase D2 (PLD2) is a guanine nucleotide exchange factor (GEF) for the GTPase Rac2. (nih.gov)
Kinase1
14. Phospholipase D2-derived phosphatidic acid binds to and activates ribosomal p70 S6 kinase independently of mTOR. (nih.gov)
Fibroblast2
Interestingly, although mTid-1 is found tyrosine-phosphorylated in v-src-transformed fibroblast cells, GAP selectively binds to the unphosphorylated form of mTid-1. (embl.de)
In immunofluorescence experiments, GAP and Tid-1 were shown to colocalize at perinuclear mitochondrial membranes in response to epidermal growth factor stimulation. (embl.de)
This entry represents the catalytic domain of the Ras guanine-nucleotide exchange factors. (embl.de)
Vitro1
In COS-1 cells, the DH domain of Sos stimulated guanine nucleotide exchange on Rac but not Cdc42 in vitro and in vivo. (embl.de)
STAT35
Also plays a role in PDGF-mediated tyrosine phosphorylation of both STAT1 and STAT3, leading to increased DNA binding activity of these transcription factors. (drugbank.com)
We identified an IL-21 response element downstream of Prdm1 that binds the transcription factors STAT3 and IRF4, which are required for optimal Prdm1 expression. (gsea-msigdb.org)
Genome-wide ChIP-Seq mapping of STAT3- and IRF4-binding sites showed that most regions with IL-21-induced STAT3 binding also bound IRF4 in vivo, and furthermore, revealed that the noncanonical TTCnnnTAA GAS motif critical in Prdm1 was broadly used for STAT3 binding. (gsea-msigdb.org)
Comparing genome-wide expression array data to binding sites revealed that most IL-21-regulated genes were associated with combined STAT3-IRF4 sites rather than pure STAT3 sites. (gsea-msigdb.org)
Correspondingly, ChIP-Seq analysis of Irf4_/_ T cells showed greatly diminished STAT3 binding after IL-21 treatment, and Irf4_/_ mice showed impaired IL- 21-induced Tfh cell differentiation in vivo. (gsea-msigdb.org)
Extrinsic1
77 Synchronicity of ventricular contraction 78 Reflexes arising from the heart 78 Renal function 78 Extrinsic (autonomic) factors 78 Intrinsic factors (autoregulation) 79 Renal blood flow distribution 79 Kallidin and renal function 80 Catechol amines 80 Norepinephrine refractoriness 80 Action of ephedrine sulfate 80 Laboratory of kidney and electrolyte metabolism. (nih.gov)
A main feature of the catalytic domain is the protrusion of a helical hairpin important for the nucleotide-exchange mechanism. (embl.de)
Phosphorylation of AFAP1 allows the SRC SH2 domain to bind AFAP1 and to localize to actin filaments. (drugbank.com)
Therapeutic2
In the broadest sense the study of signaling mechanisms has already yielded therapeutic brokers in the treatment of malignancy as evidenced by antiestrogens antiandrogens agonists of gonadotropin-releasing hormone and stem cell growth factors for example. (ecologicalsgardens.com)
Table 1 Examples of inhibitors of growth factor signaling for cancer treatment Growth factor receptors Efforts to inhibit HER-2 yielded the first cancer therapeutic agent based on research in growth factor signaling. (ecologicalsgardens.com)
Phosphorylation1
phosphorylation by Lck increased its capacity to stimulate the GDP/GTP exchange on Ha-Ras, whereas its phosphorylation by p60c-Src was ineffective. (embl.de)