Limbatustoxin
LbTX displays 57% sequence homology with charybdotoxin and 70% sequence homology with iberiotoxin. LbTX contains a β-sheet ... Based on the 70% homology with iberiotoxin, it seems likely that the limbatustoxin selectively inhibits the current through the ...
ALPL
... purification and partial sequencing: homology with the placental isozyme". Archives of Biochemistry and Biophysics. 245 (2): ... Sato N, Takahashi Y, Asano S (February 1994). "Preferential usage of the bone-type leader sequence for the transcripts of liver ... Kishi F, Matsuura S, Kajii T (March 1989). "Nucleotide sequence of the human liver-type alkaline phosphatase cDNA". Nucleic ...
OBPgp279
... due to the presence of a conserved sequence motif (general sequence motif = [FHY]-G-R-G-[AP]-ζ-Q-[IL]-[ST]-[FHYW]-[HN]-[FY]-[NY ... Udaya Prakash NA, Jayanthi M, Sabarinathan R, Kangueane P, Mathew L, Sekar K (May 2010). "Evolution, homology conservation, and ... general sequence motif = D-G-(Pho)2-G-K/N-G/N-T, Pho = hydrophobic amino acid), it likely contains two peptidoglycan binding ... identification of unique sequence signatures in GH19 family chitinases". Journal of Molecular Evolution. 70 (5): 466-78. ...
Calliphora vomitoria
... neuropeptides from the blowfly Calliphora vomitoria with sequence homology to cockroach allatostatins". Proceedings of the ...
Interleukin-1 family
IL-36ra is 155 amino acids long and lacks a signal sequence. IL-36ra shares with IL-1ra 52% homology in the amino acid sequence ... Mouse, rat and rabbit IL-1ra show 77, 75, and 78% sequence homology to human IL-1ra. L-1ra shows approximately 30% homology to ... The other 2 forms, commonly referred to as icIL-1ra or IL-1ra2 and IL-1ra3, do not have a signal sequence, are not secreted, ... IL-13 is very similar to IL-4 in amino acid sequence and structure. They also used the same type II IL-4 receptor to activate ...
Triptan
There is a high homology in the amino acid sequence within each family. Each family couples to the same second messenger ...
Ixodes holocyclus
The gene sequence of the tick toxin shows high homology to scorpion toxins. The saliva of Ixodes holocyclus also contains an ...
Fluorescence in situ hybridization
This homology can be detected by gene or genome sequencing but also by FISH. For instance, human and chimpanzee chromosomes are ... "Observations on chromosome-specific sequencing for the construction of cross-species chromosome homology maps and its ... Repetitive DNA sequences must be blocked by adding short fragments of DNA to the sample. The probe is then applied to the ... In biology, a probe is a single strand of DNA or RNA that is complementary to a nucleotide sequence of interest. RNA probes can ...
Janice E. Clements
"Sequence homology and morphologic similarity of HTLV-III and visna virus, a pathogenic lentivirus". Science. 227 (4683): 173-7 ...
DNA shuffling
The disadvantages of StEP include that it is time consuming and requires sequence homology. SCOPE (protein engineering) Glick ... Nonhomologous random recombination differs from molecular breeding as homology of the ligated sequences is not necessary which ... Primers may be chosen to have additional sequences added on to their 5' ends, such as sequences for restriction enzyme ... Next, T4 DNA ligase is employed to ligate the fragments to form extended sequences. The ligation of the hairpins to the ...
Michael Stuart Brown
... sequence homology with the epidermal growth factor precursor". Cell. 37 (2): 577-85. doi:10.1016/0092-8674(84)90388-X. PMID ... 1984). "Nucleotide sequence of 3-hydroxy-3-methyl-glutaryl coenzyme A reductase, a glycoprotein of endoplasmic reticulum". ... Nov 1984). "The human LDL receptor: a cysteine-rich protein with multiple Alu sequences in its mRNA". Cell. 39 (1): 27-38. doi: ... Osborne TF, Goldstein JL, Brown MS (Aug 1985). "5' end of HMG CoA reductase gene contains sequences responsible for cholesterol ...
Altitoxin
... has sequence homology to scorpion β-toxins, suggesting it might target sodium channels. However, its depressing ... Altitoxin, with the amino acid sequence ADVPGNYPLDKDGNTYTCLELGENKDCQKVCKLHGVQYGYCYAFFCWCKELDDKDVSV, is 58 amino acid residues ... It has large homology to other toxins from the venom of Parabuthus transvaalicus, including bestoxin, birtoxin, ikitoxin and ...
KLK1
Lottspeich F, Geiger R, Henschen A, Kutzbach C (1980). "N-Terminal amino acid sequence of human urinary kallikrein homology ... Complete amino acid sequence and sites of glycosylation". Int. J. Pept. Protein Res. 33 (4): 237-49. doi:10.1111/j.1399- ... 1996). "Evaluation of the extent of the binding site in human tissue kallikrein by synthetic substrates with sequences of human ... Baker AR, Shine J (1986). "Human kidney kallikrein: cDNA cloning and sequence analysis". DNA. 4 (6): 445-50. doi:10.1089/dna. ...
Aminoacyl tRNA synthetases, class I
These proteins differ widely in size and oligomeric state, and have limited sequence homology. The 20 aminoacyl-tRNA ... according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, ... Cusack S, Leberman R, Hartlein M (1991). "Sequence, structural and evolutionary relationships between class 2 aminoacyl-tRNA ... "Partition of tRNA synthetases into two classes based on mutually exclusive sets of sequence motifs". Nature. 347 (6289): 203- ...
Cog
... see Sequence homology and MicrobesOnline Conserved oligomeric Golgi complex, that includes COG2, COG4, etc. INSEE code (also ...
ORM1
Dente L, Ciliberto G, Cortese R (1985). "Structure of the human alpha 1-acid glycoprotein gene: sequence homology with other ... The complete amino acid sequence, multiple amino acid substitutions, and homology with the immunoglobulins". Biochemistry. 12 ( ... Board PG, Jones IM, Bentley AK (1986). "Molecular cloning and nucleotide sequence of human alpha 1 acid glycoprotein cDNA". ... acid glycoprotein and the elucidation of the amino acid sequence of the carboxyl-terminal cyanogen bromide fragment". ...
BBS10
The Bardet-Biedl syndrome 10 protein has distant sequence homology to type II chaperonins. As a molecular chaperone, this ... 2004). "Complete sequencing and characterization of 21,243 full-length human cDNAs". Nat. Genet. 36 (1): 40-5. doi:10.1038/ ... 2002). "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences". Proc. Natl. Acad. Sci ...
Purple acid phosphatases
... sequence homology in PAPs of plant origin. However sequence analysis reveals that there is minimal homology between plant and ... PAPs are highly conserved within eukaryotic species, with >80% amino acid homology in mammalian PAPs, and >70% ...
Journal of Biomolecular NMR
"Protein backbone angle restraints from searching a database for chemical shift and sequence homology". Journal of Biomolecular ...
West Caucasian bat lyssavirus
The lyssavirus genus can be divided into four phylogroups based upon DNA sequence homology. Phylogroup I includes viruses, such ...
Proliferating cell nuclear antigen
Part of the protein was sequenced and that sequence was used to allow isolation of a cDNA clone. PCNA helps hold DNA polymerase ... homology with DNA-binding proteins". Proceedings of the National Academy of Sciences of the United States of America. 84 (6): ... Chen M, Pan ZQ, Hurwitz J (April 1992). "Sequence and expression in Escherichia coli of the 40-kDa subunit of activator 1 ( ... Almendral JM, Huebsch D, Blundell PA, Macdonald-Bravo H, Bravo R (March 1987). "Cloning and sequence of the human nuclear ...
GTx1-15
... displays sequence homology with other ion channel toxins from several spider species. It is homologous in sequence with ... Kimura T, Ono S, Kubo T (2012). "Molecular Cloning and Sequence Analysis of the cDNAs Encoding Toxin-Like Peptides from the ... GTx1-15 is composed of 34 amino acid residues; its sequence has been determined to be DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCQYVF. This ... sodium channel blocker PaurTx3 by 76.5%, and it also shares similarities in sequence with HnTx-IV (60%), CcoTx2 (55.9%), TLTx1 ...
Lyssavirus
The lyssavirus genus can be divided into four phylogroups based upon DNA sequence homology. Phylogroup I includes viruses, such ... However, the recent discovery of lyssavirus sequences from amphibians and reptiles challenges the mammalian origin of ... and West Caucasian bat viruses within the Lyssavirus genus and suggested quantitative criteria based on the N gene sequence for ...
Phospholipase C
There is significant homology of the sequences, approximately 250 residues, from the N-terminus. Alpha-toxin has an additional ... The core enzyme includes a split triosephosphate isomerase (TIM) barrel, pleckstrin homology (PH) domain, four tandem EF hand ... and PLCs from Clostridium bifermentans and Listeria monocytogenes have been isolated and nucleotides sequenced. ...
Visna-maedi virus
Despite limited sequence homology with HIV, the genomic organization of visna is very similar, allowing visna infection to be ... Gonda, MA; Wong-Staal, F; Gallo, RC; Clements, JE; Narayan, O; Gilden, RV (January 1985). "Sequence homology and morphologic ... The genome sequence is flanked by 5' and 3' long terminal repeats (LTRs).[citation needed] The viral LTRs are essential for ... Nucleotide sequence analysis demonstrated that the AIDS virus was a retrovirus related to visna and provided early clues as to ...
Calpastatin
1991). "cDNA cloning of human calpastatin: sequence homology among human, pig, and rabbit calpastatins". J. Enzym. Inhib. 3 (1 ...
Bile salt-dependent lipase
Sequence similarity with rat lysophospholipase and homology with the active site region of cholinesterases". FEBS Lett. 278 (2 ... 1992). "Genomic organization, sequence analysis, and chromosomal localization of the human carboxyl ester lipase (CEL) gene and ... Hui DY, Kissel JA (1991). "Sequence identity between human pancreatic cholesterol esterase and bile salt-stimulated milk lipase ...
RFX1
... contains a C-terminal sequence with no apparent homology to other RFX proteins. This C-terminal tail contains an acidic ... The RFX proteins were originally cloned and characterized due to their high affinity for a cis-acting promoter sequence, called ... 2003). "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences". Proc. Natl. Acad. Sci ... 2003). "RFX1 and NF-1 associate with P sequences of the human growth hormone locus in pituitary chromatin". Mol. Endocrinol. 17 ...
5-HT1E receptor
They share 57% amino acid sequence homology and have some pharmacological characteristics in common. Both receptors are Gi- ... indicating a high degree of evolutionary conservation of genetic sequence, which suggests that the 5-HT1E receptor has an ...
Phrap
... sequences. (Affine gaps are helpful for homology searches but not usually for sequencing error alignment). Phrap attempts to ... If a consensus base is covered by both high-quality sequence and (discrepant) low-quality sequence, Phrap's selection of the ... PMID 7753633 Krawetz SA (1989): Sequence errors described in GenBank: a means to determine the accuracy of DNA sequence ... Phrap examines the quality scores of the aligned sequences to find the highest quality sequence. In the process, Phrap takes ...