SNTB1
Nucleic Acids Res. 30 (14): 3163-70. doi:10.1093/nar/gkf428. PMC 135748. PMID 12136098. Gevaert K, Goethals M, Martens L, Van ... "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides". Nat. ...
Nest (protein structural motif)
Watson, JD; Laskowski (2005). "ProFunc: a server for predicting protein function from 3D structure". Nucleic Acids Research. 33 ... The synthesized peptide Ser-Gly-Ala-Gly-Lys-Thr, designed as a minimal peptide P-loop, was shown to bind inorganic phosphate ... About one in 12 of amino acid residues in proteins, on average, belongs to a nest. The conformation of a nest is such that the ... A few have so little that the concavity is lost; these peptides often bind cations via their main chain CO groups, instead of ...
Endoplasmic reticulum
A ribosome only binds to the RER once a specific protein-nucleic acid complex forms in the cytosol. This special complex forms ... The first 5-30 amino acids polymerized encode a signal peptide, a molecular message that is recognized and bound by a signal ... The N-terminus (one end) of a polypeptide chain (i.e., a protein) contains a few amino acids that work as an address tag, which ... Nascent peptides reach the ER via the translocon, a membrane-embedded multiprotein complex. Proteins that are destined for ...
VPS29
2006). "The LIFEdb database in 2006". Nucleic Acids Res. 34 (Database issue): D415-8. doi:10.1093/nar/gkj139. PMC 1347501. PMID ... Vps29 retromer component is a metallo-phosphoesterase for a cation-independent mannose 6-phosphate receptor substrate peptide ...
Protein fold class
Andreeva, A (2014). "SCOP2 prototype: a new approach to protein structure mining". Nucleic Acids Res. 42 (Database issue): D310 ... These predicted sequences can then be validated experimentally through methods such as peptide synthesis, site-directed ... Nucleic Acids Research. 35 (suppl 1): D291-D297. doi:10.1093/nar/gkl959. ISSN 0305-1048. PMC 1751535. PMID 17135200. Fox, Naomi ... Nucleic Acids Research. 25 (1): 236-239. doi:10.1093/nar/25.1.236. ISSN 0305-1048. PMC 146380. PMID 9016544. Greene, Lesley H ...
Søren Brunak
Nucleic Acids Research. 18 (16): 4797-4801. doi:10.1093/nar/18.16.4797. PMC 331948. PMID 2395643. Brunak, S.; Engelbrecht, J.; ... Dyrløv Bendtsen, J.; Nielsen, H.; Von Heijne, G.; Brunak, S. (2004). "Improved Prediction of Signal Peptides: SignalP 3.0". ... discriminating signal peptides from transmembrane regions". Nature Methods. 8 (10): 785-786. doi:10.1038/nmeth.1701. ISSN 1548- ... "Predicting Subcellular Localization of Proteins Based on their N-terminal Amino Acid Sequence". Journal of Molecular Biology. ...
Open reading frame
Nucleic Acids Research. 42 (Database issue): D60-D67. doi:10.1093/nar/gkt952. PMC 3964959. PMID 24163100. Geballe, A. P.; ... The output is the predicted peptide sequences in the FASTA format, and a definition line that includes the query ID, the ... The deduced amino acid sequence can be saved in various formats and searched against the sequence database using the basic ... The tool efficiently finds the ORFs for corresponding amino acid sequences and converts them into their single letter amino ...
FGFR1OP2
Nucleic Acids Res. 30 (1): 207-10. doi:10.1093/nar/30.1.207. PMC 99122. PMID 11752295. Baba, N (2012). "The aryl hydrocarbon ... discriminating signal peptides from transmembrane regions". Nature Methods. 8 (10): 785-786. doi:10.1038/nmeth.1701. PMID ... Transcript variant 1 consists of 253 amino acids and weighs 29.4 kilodaltons. FGFR1OP2's isoelectric point is 5.61. The ...
Structure
The primary structure is the sequence of amino acids that make it up. It has a peptide backbone made up of a repeated sequence ... In another context, structure can also observed in macromolecules, particularly proteins and nucleic acids. The function of ...
Helen M. Berman
"The nucleic acid database. A comprehensive relational database of three-dimensional structures of nucleic acids". Biophysical ... Bella J, Eaton M, Brodsky B, Berman HM (1994). "Crystal and molecular structure of a collagen-like peptide at 1.9 Å resolution ... she co-founded the Nucleic Acid Database (NDB) to collect and disseminate information about nucleic acid structure. At Rutgers ... About the Nucleic Acid Database Archived 2008-09-20 at the Wayback Machine Benoff B, Yang H, Lawson CL, Parkinson G, Liu J, ...
Cecropin
... triggered by the inhibition of efflux pump activity and interactions with extracellular and intracellular nucleic acids. ... May 2009). "Structure and function of a custom anticancer peptide, CB1a". Peptides. 30 (5): 839-48. doi:10.1016/j.peptides. ... All of these peptides are structurally related. Members include: Cecropin A Peptide Sequence ( ... at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary ...
Fibrous protein
Andreeva, A (2014). "SCOP2 prototype: a new approach to protein structure mining". Nucleic Acids Res. 42 (Database issue): D310 ... A fibrous protein's peptide sequence often has limited residues with repeats; these can form unusual secondary structures, such ...
Immunoscreening
Karam, James (November 26, 1990). Methods in Nucleic Acids Research. CRC Press. p. 309. ISBN 0849353114. Mukerjee S, McKnight ... and analyzing antibody-peptide interactions. Clones are screened for the presence of the gene product: the resulting protein. ... a method for selection of anti-peptide monoclonal antibodies for use in immunoproteomics". Journal of Immunological Methods. ...
Tyrosine
"Nomenclature and Symbolism for Amino Acids and Peptides". IUPAC-IUB Joint Commission on Biochemical Nomenclature. 1983. ... "Precision neutron diffraction structure determination of protein and nucleic acid components. X. A comparison between the ... Proteinogenic amino acids, Glucogenic amino acids, Ketogenic amino acids, Alpha-Amino acids, Aromatic amino acids, Phenols, ... which in turn can be oxidized by the citric acid cycle or be used for fatty acid synthesis. Phloretic acid is also a urinary ...
Protein secondary structure
Both protein and nucleic acid secondary structures can be used to aid in multiple sequence alignment. These alignments can be ... Peptide Science. 5 (4): 249-66. doi:10.2174/1389203043379675. PMID 15320732. Pirovano W, Heringa J (2010). "Protein secondary ... Karplus K (2009). "SAM-T08, HMM-based protein structure prediction". Nucleic Acids Res. 37 (Web Server issue): W492-97. doi: ... Other types of biopolymers such as nucleic acids also possess characteristic secondary structures. The most common secondary ...
Muhammad Imran Qadir
These are synthetic peptides composed of 36 and 30 amino acids respectively. These block the entry of HIV genome into human CD4 ... Nucleic acid analysis confirmed the presence of RNA with a size of approximately 20 kb. Transmission electron microscopy ... This drug is a synthetic peptide composed of 30 amino acids. It is part of Heptad Repeat 2 (HR2) region of spike protein of ...
Nanochemistry
Nanodiamonds can self-assemble and a wide range of small molecules, proteins antibodies, therapeutics, and nucleic acids can ... Other potential biomedical applications are the use of nanodiamonds as support for solid-phase peptide synthesis and as ... The surfaces of these nanodiamonds are terminated with carboxylic acid groups, enabling their attachment to amine-terminated ...
PPIH
2004). "Two protein-protein interaction sites on the spliceosome-associated human cyclophilin CypH". Nucleic Acids Res. 31 (16 ... 2003). "Crystal structure of a complex between human spliceosomal cyclophilin H and a U4/U6 snRNP-60K peptide". J. Mol. Biol. ... PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of ...
Nanopore sequencing
These substrates most often serve integral roles in the sequence recognition of nucleic acids as they translocate through the ... MspA with electric current detection can also be used to sequence peptides. Solid state nanopore sequencing approaches, unlike ... Deamer DW, Akeson M (April 2000). "Nanopores and nucleic acids: prospects for ultrarapid sequencing". Trends in Biotechnology. ... The natural nanopore was modified to improve translocation by replacing three negatively charged aspartic acids with neutral ...
FKBP4
"Structural basis of nucleic acid recognition by FK506-binding protein 25 (FKBP25), a nuclear immunophilin". Nucleic Acids ... Regulatory Peptides. 97 (2-3): 147-52. doi:10.1016/S0167-0115(00)00206-8. PMID 11164950. S2CID 20617551. Prakash, Ajit; Shin, ... Regulatory Peptides. 97 (2-3): 147-52. doi:10.1016/S0167-0115(00)00206-8. PMID 11164950. S2CID 20617551. Galigniana MD, Radanyi ...
Amino acid activation
... new evidence of D-amino acids activation and editing". Nucleic Acids Research. 47 (18): 9777-9788. doi:10.1093/nar/gkz756. PMC ... Amino acid activation is a prerequisite to the initiation of translation and protein synthesis. Peptide bond formation is an ... "Prebiotic Peptide Bond Formation Through Amino Acid Phosphorylation. Insights from Quantum Chemical Simulations". Life - via ... Activation thus enhances the reactivity of the amino acid and drives peptide bond synthesis. Moreover, the inorganic ...
Jason Micklefield
The Micklefield lab is also engaged in nucleic acids research, re-engineering the first orthogonal riboswitches (genetic tools ... "Introduction of a Non-Natural Amino Acid into a Nonribosomal Peptide Antibiotic by Modification of Adenylation Domain ... "An Enzyme Cascade for Selective Modification of Tyrosine Residues in Structurally Diverse Peptides and Proteins". Journal of ... creating alternative bioalkylation pathways and developed methods for selective derivatisation of tyrosine residues in peptides ...
Fungal mating pheromone receptors
Nucleic Acids Res. 13 (23): 8463-8475. doi:10.1093/nar/13.23.8463. PMC 322145. PMID 3001640. Herskowitz I, Marsh L (1988). " ... October 2001). "Structure and topology of a peptide segment of the 6th transmembrane domain of the Saccharomyces cerevisiae ... The amino acid sequences of both receptors contain high proportions of hydrophobic residues grouped into 7 domains, in a manner ... kluyveri is a member of the rhodopsin/beta-adrenergic receptor family and is responsible for recognition of the peptide ligand ...
Internal ribosome entry site
Kozak M (2005). "A second look at cellular mRNA sequences said to function as internal ribosome entry sites". Nucleic Acids ... Xia, Qingyou; Ping Zhao; Wang, Riyuan; Wang, Feng; Wang, Yuancheng (2015-11-05). "2A self-cleaving peptide-based multi-gene ... Nucleic Acids Research. 34 (Database issue): D125-30. doi:10.1093/nar/gkj081. PMC 1347444. PMID 16381829. Alberts B, Johnson A ... Nucleic Acids Research. 19 (16): 4485-4490. doi:10.1093/nar/19.16.4485. ISSN 0305-1048. PMC 328638. PMID 1653417. ...
Hydrolase
... peptide bonds (Proteases/peptidases) EC 3.5: carbon-nitrogen bonds, other than peptide bonds EC 3.6 acid anhydrides (acid ... a nuclease is a hydrolase that cleaves nucleic acids. Hydrolases are classified as EC 3 in the EC number classification of ... Fatty acids and other small molecules are used for synthesis and as a source of energy. In biochemistry, a hydrolase is an ... Acetic acid is an important metabolite in the body and a critical intermediate for other reactions such as glycolysis. Lipases ...
Fluorescence microscope
Major examples of these are nucleic acid stains such as DAPI and Hoechst (excited by UV wavelength light) and DRAQ5 and DRAQ7 ( ... A new peptide, known as the Collagen Hybridizing Peptide, can also be conjugated with fluorophores and used to stain denatured ... Others are drugs, toxins, or peptides which bind specific cellular structures and have been derivatised with a fluorescent ...
Myophosphorylase
"UniProt: the universal protein knowledgebase". Nucleic Acids Research. 45 (D1): D158-D169. January 2017. doi:10.1093/nar/ ... Role of the peptide region surrounding the phosphoserine residue in determining enzyme properties". The Journal of Biological ...
Association of Biomolecular Resource Facilities
Protein/Peptide Chemistry: amino acid analysis, N- and C-terminal sequencing, peptide synthesis, peptide/protein arrays. ... Microscopy light microscopy and imaging, Confocal Microscopy Nucleic Acid Chemistry: DNA sequencing, DNA synthesis, RNA ... Nucleic Acids Research Group (NARG) Protein Expression Research Group (PERG) Protein Sequencing Research Group (PSRG) ... The next year protein sequencing and amino acid samples were sent to survey 103 core facilities. By 1989 the ABRF was formally ...
Halovir
These peptides display interesting microheterogeneity; slight variation in encoding amino acids gives rise to a mixture of ... Nucleic Acids Research. 32 (Database issue): D593-D594. doi:10.1093/nar/gkh077. ISSN 0305-1048. PMC 308811. PMID 14681489. ... α-dialkylated non-proteinogenic amino acids [α-aminoisobutyric acid (Aib), isovaleric acid (Iva), hydroxyproline (Hyp)]. In ... α-dialkylated amino acid residues in peptaibols create substantial conformation constrictions in the peptide backbone, ...
DDX43
Nucleic Acids Res. 34 (Database issue): D415-8. doi:10.1093/nar/gkj139. PMC 1347501. PMID 16381901. Mathieu MG, Knights AJ, ... identification of several MHC class I/II HAGE-derived immunogenic peptides". Cancer Immunol. Immunother. 56 (12): 1885-95. doi: ...
Myogenin
Pearson-White SH (March 1991). "Human MyoD: cDNA and deduced amino acid sequence". Nucleic Acids Research. 19 (5): 1148. doi: ... peptide growth factors and signaling pathways involving G proteins". The Journal of Cell Biology. 115 (4): 905-17. doi:10.1083/ ... Nucleic Acids Research. 27 (18): 3752-61. doi:10.1093/nar/27.18.3752. PMC 148632. PMID 10471746. Onions J, Hermann S, ...