Glucagon-like peptide-2
Glucagon-like peptide 2 receptor Akita, Tomomi; Kimura, Ryosuke; Akaguma, Saki; Nagai, Mio; Nakao, Yusuke; Tsugane, Mamiko; ... Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see ... of cell-penetrating peptides and penetration accelerating sequence for nose-to-brain delivery of glucagon-like peptide-2". ... post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 ( ...
Glucagon-like peptide-2 receptor
Like glucagon-like peptide-1 (GLP1) and glucagon itself, it is derived from the proglucagon peptide encoded by the GCG gene. ... Glucagon-like peptide-2 receptor (GLP-2R) is a protein that in human is encoded by the GLP2R gene located on chromosome 17. The ... "Entrez Gene: Glucagon-like peptide 2 receptor". Burrin DG, Petersen Y, Stoll B, Sangild P (Mar 2001). "Glucagon-like peptide 2 ... Glucagon-Like Peptide-2 Receptor at the U.S. National Library of Medicine Medical Subject Headings (MeSH) This article ...
Glucagon-like peptide-1 receptor
"Crystal structure of glucagon-like peptide-1 in complex with the extracellular domain of the glucagon-like peptide-1 receptor ... GLP1R binds glucagon-like peptide-1 (GLP1) and glucagon as its natural endogenous agonists. Agonists: GLP-1 - endogenous in ... The glucagon-like peptide-1 receptor (GLP1R) is a receptor protein found on beta cells of the pancreas and on neurons of the ... Glucagon-like peptide-1 (GLP-1) is a hormone consisting of 30 amino acids. It is released by intestinal L cells when nutrients ...
Free fatty acid receptor 2
This stimules these cells to secrete GLP-1 (i.e., glucagon-like peptide-1) and PYY (i.e., peptide YY) into the blood. GLP-1 ... "Glucagon-like peptide 1 (GLP-1)". Molecular Metabolism. 30: 72-130. doi:10.1016/j.molmet.2019.09.010. PMC 6812410. PMID ... Since insulin causes cells to take up blood glucose and glucagon causes the liver to release glucose into the blood, FFAR2 ... and Combined Glucometabolic Effects of Endogenous Glucose-Dependent Insulinotropic Polypeptide and Glucagon-like Peptide 1 in ...
Glucagon-like peptide-1
Glucagon-like peptide 1 receptor Glucagon-like peptide-2 Type 2 diabetes GLP-1 analogs : exenatide, liraglutide, dulaglutide, ... Glucagon-like peptide-1 (GLP-1) is a 30- or 31-amino-acid-long peptide hormone deriving from the tissue-specific ... Mojsov, S; Weir, G C; Habener, J F (1987-02-01). "Insulinotropin: glucagon-like peptide I (7-37) co-encoded in the glucagon ... "Glucagon-like peptide-1 decreases endogenous amyloid-beta peptide (Abeta) levels and protects hippocampal neurons from death ...
Amylin Pharmaceuticals
Garber, Alan J. (2011-05-01). "Long-Acting Glucagon-Like Peptide 1 Receptor Agonists". Diabetes Care. 34 (Supplement 2): S279- ... John Eng licensed to Amylin exendin-4, a peptide he had isolated in the venom of a Gila monster. Exendin-4 is similar to the ... "FDA Approves Symlin for Type 1 and Type 2 Diabetes". 2005-03-18. Retrieved 2017-05-26. "Dr. John Eng's Research Found That The ... human gut hormone GLP-1, which is responsible for regulating insulin and glucagon release. Unlike human GLP-1, however, exendin ...
Taspoglutide
... is a former experimental drug, a glucagon-like peptide-1 agonist (GLP-1 agonist), that was under investigation for ... Baggio LL, Drucker DJ (2008). "Glucagon-like Peptide-1 Analogs Other Than Exenatide". "Ipsen's Partner Roche Announces That ... Glucagon-like peptide-1 receptor agonists, Abandoned drugs, All stub articles, Gastrointestinal system drug stubs). ... 36-L-argininamide derivative of the amino acid sequence 7-36 of human glucagon-like peptide I. Incretin "Ipsen: Roche Moves ...
Semaglutide
... is a glucagon-like peptide-1 receptor agonist. By mimicking the action of the incretin glucagon-like peptide-1 (GLP ... It is a peptide similar to the hormone glucagon-like peptide-1 (GLP-1), modified with a side chain. It can be administered by ... April 2010). "Glucagon-like Peptide-1 receptor agonists activate rodent thyroid C-cells causing calcitonin release and C-cell ... Semaglutide is a glucagon-like peptide-1 receptor agonist. The most common side effects include nausea, vomiting, diarrhea, ...
Exenatide
... binds to the intact human Glucagon-like peptide-1 receptor (GLP-1R) in a similar way to the human peptide glucagon- ... Exenatide is a glucagon-like peptide-1 receptor agonist (GLP-1 receptor agonist) also known as incretin mimetics. It works by ... Ali ES, Hua J, Wilson CH, Tallis GA, Zhou FH, Rychkov GY, Barritt GJ (September 2016). "The glucagon-like peptide-1 analogue ... Shyangdan DS, Royle P, Clar C, Sharma P, Waugh N, Snaith A (October 2011). "Glucagon-like peptide analogues for type 2 diabetes ...
Liraglutide
... is a glucagon-like peptide-1 receptor agonist (GLP-1 receptor agonist) also known as incretin mimetics. It works by ... Shyangdan DS, Royle P, Clar C, Sharma P, Waugh N, Snaith A (October 2011). "Glucagon-like peptide analogues for type 2 diabetes ... Liraglutide has been shown to lead to greater weight loss than other glucagon-like peptide analogues. At exposures eight times ... Glucagon-like peptide-1 receptor agonists, Peptide hormones). ... Liraglutide is an acylated glucagon-like peptide-1 (GLP-1) ...
Drug discovery
Shyangdan DS, Royle P, Clar C, Sharma P, Waugh N, Snaith A (October 2011). "Glucagon-like peptide analogues for type 2 diabetes ... Ciemny M, Kurcinski M, Kamel K, Kolinski A, Alam N, Schueler-Furman O, Kmiecik S (May 2018). "Protein-peptide docking: ... 88 (Suppl 2): 7-10, discussion 49-50. doi:10.1111/j.1464-410X.2001.00112.x. PMID 11589663. Lee JA, Uhlik MT, Moxham CM, Tomandl ... 2 (3): 251-286. doi:10.3390/medicines2030251. PMC 5456217. PMID 28930211. Oishi S, Kimura SI, Noguchi S, Kondo M, Kondo Y, ...
Sulfonylurea
Shyangdan DS, Royle P, Clar C, Sharma P, Waugh N, Snaith A (October 2011). "Glucagon-like peptide analogues for type 2 diabetes ... The same review did not find improvement of fasting C-peptide following treatment with sulfonylurea. Still, it is important to ... The functional group consists of a sulfonyl group (-S(=O)2) with its sulphur atom bonded to nitrogen atom of a ureylene group ( ... 2 (3): E162-E175. doi:10.9778/cmajo.20130073. PMC 4185978. PMID 25295236. Hemmingsen B, Schroll JB, Lund SS, Wetterslev J, ...
Diabetes medication
Shyangdan DS, Royle P, Clar C, Sharma P, Waugh N, Snaith A (October 2011). "Glucagon-like peptide analogues for type 2 diabetes ... The two main candidate molecules that fulfill criteria for being an incretin are glucagon-like peptide-1 (GLP-1) and gastric ... Exenatide, together with liraglutide, led to greater weight loss than glucagon-like peptide analogues. Liraglutide, a once- ... Liraglutide, together with exenatide, led to greater weight loss than glucagon-like peptide analogues. Taspoglutide is ...
Glucagon
Cortisol Diabetes mellitus Glucagon-like peptide-1 Glucagon-like peptide-2 Insulin Islets of Langerhans Pancreas Proglucagon ... glucagon-like peptide 1 (72-107 or 108), and glucagon-like peptide 2 (126-158). In rodents, the alpha cells are located in the ... Increased urea production Glucagon-like peptide-1 Glucagon generally elevates the concentration of glucose in the blood by ... Excising the eyestalk in young crayfish produces glucagon-induced hyperglycemia. Glucagon binds to the glucagon receptor, a G ...
Glucose-dependent insulinotropic polypeptide
GIP, along with glucagon-like peptide-1 (GLP-1), belongs to a class of molecules referred to as incretins, which stimulate ... Meier JJ, Nauck MA (2005). "Glucagon-like peptide 1(GLP-1) in biology and pathology". Diabetes/Metabolism Research and Reviews ... Thorens B (Dec 1995). "Glucagon-like peptide-1 and control of insulin secretion". Diabète & Métabolisme. 21 (5): 311-8. PMID ... It has traditionally been named gastrointestinal inhibitory peptide or gastric inhibitory peptide and was found to decrease the ...
Omarigliptin
Dupre J, Behme MT, Hramiak IM, McFarlane P, Williamson MP, Zabel P, McDonald TJ (June 1995). "Glucagon-like peptide I reduces ... Behme MT, Dupré J, McDonald TJ (April 2003). "Glucagon-like peptide 1 improved glycemic control in type 1 diabetes". BMC ... It inhibits DPP-4 to increase incretin levels (GLP-1 and GIP), which inhibit glucagon release, which in turn increases insulin ... Regulatory Peptides. 128 (2): 159-65. doi:10.1016/j.regpep.2004.06.001. PMID 15780435. S2CID 9151210. ...
Dipeptidyl peptidase-4 inhibitor
Dupre J, Behme MT, Hramiak IM, McFarlane P, Williamson MP, Zabel P, McDonald TJ (June 1995). "Glucagon-like peptide I reduces ... Behme MT, Dupré J, McDonald TJ (April 2003). "Glucagon-like peptide 1 improved glycemic control in type 1 diabetes". BMC ... Glucagon increases blood glucose levels, and DPP-4 inhibitors reduce glucagon and blood glucose levels. The mechanism of DPP-4 ... Glucagon-like Peptide 1 Agonists, and Dipeptidyl Peptidase 4 Inhibitors With All-Cause Mortality in Patients With Type 2 ...
Peptide therapeutics
May 2006). "Design of a long acting peptide functioning as both a glucagon-like peptide-1 receptor agonist and a glucagon ... "Self-assembling peptides improve the stability of glucagon-like peptide-1 by forming a stable and sustained complex". Molecular ... peptide therapeutics mimic such functions. Peptide Therapeutics are seen as relatively safe and well-tolerated as peptides can ... units to the peptide to help with peptide delivery to target sites. The introduction of carbohydrates to peptides can alter the ...
Glucagon-like peptide receptor
Glucagon-like peptide 1 receptor (GLP-1R) - binds glucagon-like peptide 1 (GLP-1) Glucagon-like peptide 2 receptor (GLP-2R) - ... The glucagon-like peptide receptors (GLPRs) include the following two receptors: ... binds glucagon-like peptide 2 (GLP-2) Glucagon receptor v t e (Articles lacking sources from August 2014, All articles lacking ...
Anti-obesity medication
Glucagon-like peptide-1 (GLP-1) are peptide incretin hormones involved in blood sugar control. In 2021, one review concluded ... de Luis DA, Gonzalez Sagrado M, Conde R, Aller R, Izaola O (2007). "Decreased basal levels of glucagon-like peptide-1 after ... "Obesity Medication: Gastrointestinal Agents, Other, CNS Stimulants, Anorexiants, Glucagon-like Peptide-1 Agonists, ... Orforglipron is a non-peptide GLP-1 agonist of potential interest because it can be taken orally and is chemically simpler and ...
Albiglutide
... (trade names Eperzan in Europe and Tanzeum in the US) is a glucagon-like peptide-1 agonist (GLP-1 agonist) drug ... Madsbad S (April 2016). "Review of head-to-head comparisons of glucagon-like peptide-1 receptor agonists". Diabetes, Obesity & ... PMID 18812476.[permanent dead link] Baggio LL, Drucker DJ (2008). "Glucagon-like Peptide-1 Analogs Other Than Exenatide". KEGG ... a long-acting glucagon-like peptide-1 mimetic, in patients with type 2 diabetes". The Journal of Clinical Endocrinology and ...
Dulaglutide
It is a glucagon-like peptide-1 receptor agonist (GLP-1 agonist) consisting of GLP-1(7-37) covalently linked to an Fc fragment ... Dulaglutide binds to glucagon-like peptide 1 receptors, slowing gastric emptying and increases insulin secretion by pancreatic ... Monami M, Dicembrini I, Nardini C, Fiordelli I, Mannucci E (February 2014). "Glucagon-like peptide-1 receptor agonists and ... Simultaneously the compound reduces the elevated glucagon secretion by inhibiting alpha cells of the pancreas, as glucagon is ...
Protein kinase C
Ali ES, Hua J, Wilson CH, Tallis GA, Zhou FH, Rychkov GY, Barritt GJ (2016). "The glucagon-like peptide-1 analogue exendin-4 ... 74 (2): 378-392.e5. doi:10.1016/j.molcel.2019.02.018. PMC 6504549. PMID 30904392. Fan J, Ray P, Lu Y, Kaur G, Schwarz J, Wan L ... 332 (Pt 2): 281-92. doi:10.1042/bj3320281. PMC 1219479. PMID 9601053. Nishizuka Y (Apr 1995). "Protein kinase C and lipid ... "FDA Approves Picato® (ingenol mebutate) Gel, the First and Only Topical Actinic Keratosis (AK) Therapy With 2 or 3 Consecutive ...
Teduglutide
... (brand names Gattex in the US and Revestive in Europe) is a 33-membered polypeptide and glucagon-like peptide-2 ( ... Jeppesen PB (May 2012). "Teduglutide, a novel glucagon-like peptide 2 analog, in the treatment of patients with short bowel ... This blocks breaking down of the molecule by dipeptidyl peptidase and increases its half-life from seven minutes (GLP-2) to ... GLP-2) analog that is used for the treatment of short bowel syndrome. It works by promoting mucosal growth and possibly ...
GPR119
May 2009). "GPR119 is required for physiological regulation of glucagon-like peptide-1 secretion but not for metabolic ... 201 (2): 219-230. doi:10.1677/JOE-08-0453. PMID 19282326. Overton HA, Fyfe MC, Reynet C (March 2008). "GPR119, a novel G ... September 2011). "2-Oleoyl glycerol is a GPR119 agonist and signals GLP-1 release in humans". The Journal of Clinical ... Shah U (July 2009). "GPR119 agonists: a promising new approach for the treatment of type 2 diabetes and related metabolic ...
Glucagon-like peptide-1 receptor agonist
... s, also known as GLP-1 receptor agonists (GLP-1-RA), incretin mimetics, or GLP-1 ... 1 April 2010). "Glucagon-like Peptide-1 receptor agonists activate rodent thyroid C-cells causing calcitonin release and C-cell ... Ali ES, Hua J, Wilson CH, Tallis GA, Zhou FH, Rychkov GY, Barritt GJ (September 2016). "The glucagon-like peptide-1 analogue ... Das A, Geetha KM, Hazarika I (29 August 2019). "Contemporary Updates on the Physiology of Glucagon like Peptide-1 and Its ...
Glucagon receptor
"Tissue-specific and glucose-dependent expression of receptor genes for glucagon and glucagon-like peptide-1 (GLP-1)". Hormone ... The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family ... In humans, the glucagon receptor is encoded by the GCGR gene. Glucagon receptors are mainly expressed in liver and in kidney ... A glucagon receptor, upon binding with the signaling molecule glucagon, initiates a signal transduction pathway that begins ...
Enteroendocrine cell
L cells secrete glucagon-like peptide-1, an incretin, peptide YY3-36, oxyntomodulin and glucagon-like peptide-2. L cells are ... Drucker DJ, Nauck MA (November 2006). "The incretin system: glucagon-like peptide-1 receptor agonists and dipeptidyl peptidase- ... K cells secrete gastric inhibitory peptide, an incretin, which also promotes triglyceride storage. K cells are mostly found in ... They produce gastrointestinal hormones or peptides in response to various stimuli and release them into the bloodstream for ...
Incretin
The two main candidate peptides that fulfill criteria for an incretin are the intestinal peptides glucagon-like peptide-1 (GLP- ... Drucker DJ, Nauck MA (November 2006). "The incretin system: glucagon-like peptide-1 receptor agonists and dipeptidyl peptidase- ... and are members of the glucagon peptide superfamily. Medications based on incretins are used in the treatment of diabetes ... Some incretins (GLP-1) also inhibit glucagon release from the alpha cells of the islets of Langerhans. In addition, they slow ...
Daniel J. Drucker
Drucker, D. J.; Philippe, J; Mojsov, S; Chick, W. L.; Habener, J. F. (1987). "Glucagon-like peptide I stimulates insulin gene ... Drucker, D. J.; Nauck, M. A. (2006). "The incretin system: Glucagon-like peptide-1 receptor agonists and dipeptidyl peptidase-4 ... Early in his career Drucker studied the effect of hormones in the gut on the onset and development of Type 2 diabetes. In 1996 ... Archived from the original on 2 May 2015. "DRUCKER, Prof. Daniel Joshua". Who's Who. Vol. 2016 (online Oxford University Press ...