*  Glucagon-like peptide 1 receptor
"Crystal structure of glucagon-like peptide-1 in complex with the extracellular domain of the glucagon-like peptide-1 receptor ... GLP1R binds glucagon-like peptide-1 (GLP1) and glucagon as its natural endogenous agonists. Receptor agonists: GLP-1 - ... The glucagon-like peptide 1 receptor (GLP1R) is a receptor protein found on beta cells of the pancreas. It is involved in the ... 2016). "Glucagon-Like Peptide-1 and Its Class B G Protein-Coupled Receptors: A Long March to Therapeutic Successes". Pharmacol ...
*  Albiglutide
... (trade names Eperzan in Europe and Tanzeum in the US) is a glucagon-like peptide-1 agonist (GLP-1 agonist) drug ... 2008). "Glucagon-like Peptide-1 Analogs Other Than Exenatide". KEGG: Albiglutide. Matthew Herper for Forbes. 16 July 2012. ... Madsbad, S (2015). "Review of head‐to‐head comparisons of glucagon‐like peptide‐1 receptor agonists". Diabetes, Obesity & ... a Long-Acting Glucagon-Like Peptide-1 Mimetic, in Patients with Type 2 Diabetes". J. Clin. Endocrinol. Metab. 93 (12): 4810- ...
*  Glucagon-like peptide-2
... (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see ... Glucagon-like peptide 2 receptor Banting and Best Diabetes Centre at UT glp2. ... post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 ( ... GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs ...
*  Glucagon-like peptide 2 receptor
Like glucagon-like peptide-1 (GLP1) and glucagon itself, it is derived from the proglucagon peptide encoded by the GCG gene. ... Glucagon-like peptide 2 receptor (GLP-2R) is a protein that in human is encoded by the GLP2R gene located on chromosome 17. The ... "Entrez Gene: Glucagon-like peptide 2 receptor". Burrin DG, Petersen Y, Stoll B, Sangild P (Mar 2001). "Glucagon-like peptide 2 ... glucagon-like peptide receptor at the US National Library of Medicine Medical Subject Headings (MeSH) This article incorporates ...
*  Teduglutide
... (brand names Gattex in the US and Revestive in Europe) is a 33-membered polypeptide and glucagon-like peptide-2 ( ... Jeppesen PB (May 2012). "Teduglutide, a novel glucagon-like peptide 2 analog, in the treatment of patients with short bowel ... This blocks breaking down of the molecule by dipeptidyl peptidase and increases its half-life from seven minutes (GLP-2) to ... GLP-2) analog that is used for the treatment of short bowel syndrome. It works by promoting mucosal growth and possibly ...
*  Enteroendocrine cell
L cells secrete glucagon-like peptide-1, an incretin, pancreatic peptide YY3-36, oxyntomodulin and glucagon-like peptide-2. L ... Drucker DJ, Nauck MA (2006). "The incretin system: glucagon-like peptide-1 receptor agonists and dipeptidyl peptidase-4 ... They produce gastrointestinal hormones or peptides in response to various stimuli and release them into the bloodstream for ... The G cells secrete gastrin, post-ganglionic fibers of the vagus nerve can release gastrin-releasing peptide during ...
*  Insulin signal transduction pathway
"Direct and indirect mechanisms regulating secretion of glucagon-like peptide-1 and glucagon-like peptide-2". Canadian Journal ... Estall JL, Drucker DJ (May 2006). "Glucagon and glucagon-like peptide receptors as drug targets". Current Pharmaceutical Design ... Glucagon is delivered directly to the liver, where it connects to the glucagon receptors on the membranes of the liver cells, ... Liver cells, or hepatocytes, have glucagon receptors which allow for glucagon to attach to them and thus stimulate ...
*  Glucagon-like peptide-1
Glucagon-like peptide 1 receptor Glucagon-like peptide-2 Type 2 diabetes GLP-1 analogs : exenatide, liraglutide, dulaglutide ... Glucagon-like peptide-1 (GLP-1) is a 30 amino acid long peptide hormone deriving from the tissue-specific posttranslational ... "Glucagon-like peptide-1 decreases endogenous amyloid-beta peptide (Abeta) levels and protects hippocampal neurons from death ... 2013). "Glucagon-like peptides 1 and 2 in health and disease: A review". Peptides. 44: 75-86. doi:10.1016/j.peptides.2013.01. ...
*  Short bowel syndrome
... a glucagon-like peptide-2 analog developed by NPS Pharmaceuticals, who intend to market the agent in the United States under ... Short bowel syndrome is when there is less than 2 m (6.6 ft) of working bowel and is the most common cause of intestinal ... It usually does not develop until less than 2 m (6.6 ft) of the normally 6.1 m (20 ft) small intestine remains. Treatment may ... 30 (2): 173-85. doi:10.1016/j.bpg.2016.02.011. PMID 27086884. "Short bowel syndrome", orphanet, February 2012, archived from ...
*  Proglucagon
Glucagon Glucagon-like peptide 1 (GLP-1) Glucagon-like peptide 2 (GLP-2) Schroeder WT, Lopez LC, Harper ME, Saunders GF (1984 ... Proglucagon is a precursor of glucagon, and several other components. It is generated in the alpha cells of the pancreas and in ... White JW, Saunders GF (June 1986). "Structure of the human glucagon gene". Nucleic Acids Res. 14 (12): 4719-30. doi:10.1093/nar ... "Localization of the human glucagon gene (GCG) to chromosome segment 2q36-37". Cytogenet. Cell Genet. 38 (1): 76-9. doi:10.1159/ ...
*  TCF7L2
200 (1-2): 149-56. doi:10.1016/S0378-1119(97)00411-3. PMID 9373149. He TC, Sparks AB, Rago C, Hermeking H, Zawel L, da Costa LT ... 138 (1-2): 171-4. doi:10.1016/0378-1119(94)90802-8. PMID 8125298. Korinek V, Barker N, Morin PJ, van Wichen D, de Weger R, ... 24 (2): 293-300. doi:10.1016/j.molcel.2006.09.001. PMID 17052462. Lee JM, Dedhar S, Kalluri R, Thompson EW (March 2006). "The ... 363 (Pt 2): 253-62. doi:10.1042/0264-6021:3630253. PMC 1222473 . PMID 11931652. Leung JY, Kolligs FT, Wu R, Zhai Y, Kuick R, ...
*  Glucagon receptor family
... glucagon, glucagon-like peptide-1, glucagon-like peptide-2) derived from the proglucagon polypeptide. The last receptor binds ... Glucagon receptor Glucagon-like peptide 1 receptor Glucagon-like peptide 2 receptor Gastric inhibitory polypeptide receptor The ... "Glucagon Receptors". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical Pharmacology. ... The glucagon receptor family is a group of closely related G-protein coupled receptors which include: ...
*  Glucagon-like peptide-1 receptor agonist
... s also known as GLP-1 receptor agonists or incretin mimetics are agonists of the GLP-1 ... Baggio LL (2008). "Glucagon-like Peptide-1 Analogs Other Than Exenatide". Medscape Diabetes & Endocrinology. Ali ES, Hua J, ... "The glucagon-like peptide-1 analogue exendin-4 reverses impaired intracellular Ca2+ signalling in steatotic hepatocytes". BBA ... DPP-4 Inhibitors for Type 2 Diabetes". Liu, J; Li, L; Deng, K; Xu, C; Busse, JW; Vandvik, PO; Li, S; Guyatt, GH; Sun, X (8 June ...
*  Daniel J. Drucker
Drucker, D. J.; Philippe, J; Mojsov, S; Chick, W. L.; Habener, J. F. (1987). "Glucagon-like peptide I stimulates insulin gene ... Drucker, D. J.; Nauck, M. A. (2006). "The incretin system: Glucagon-like peptide-1 receptor agonists and dipeptidyl peptidase-4 ... In 1996, Drucker first identified the proliferative effects that GLP-2 has on small bowel proliferation in rats. Drucker ... "Exenatide once weekly versus twice daily for the treatment of type 2 diabetes: A randomised, open-label, non-inferiority study ...
*  GPR84
... where it stimulates the release of peptide hormones including incretins glucagon-like peptide (GLP) 1 and 2. The ligands for ... 101 (2): 144-53. doi:10.1016/j.imlet.2005.05.010. PMID 15993493. Wang J, Wu X, Simonavicius N, Tian H, Ling L (November 2006 ... A viral infection following Japanese encephalitis virus infection also increased GPR84 expression by 2-4.5% in the mice brain. ... Its clinical effect against inflammatory disorders like inflammatory bowel disease was being investigated in 2015 in a Phase 2 ...
*  Glucagon
Cortisol Diabetes mellitus Glucagon-like peptide-1 Glucagon-like peptide-2 Insulin Islets of Langerhans Pancreas Proglucagon ... Glucagon is a peptide (nonsteroid) hormone. Glucagon is generated from the cleavage of proglucagon by proprotein convertase 2 ... Excising the eyestalk in young crayfish produces glucagon-induced hyperglycemia. Glucagon binds to the glucagon receptor, a G ... have glucagon receptors. When glucagon binds to the glucagon receptors, the liver cells convert the glycogen into individual ...
*  Incretin
The two main candidate molecules that fulfill criteria for an incretin are the intestinal peptides glucagon-like peptide-1 (GLP ... Glucagon-like peptide-1 analogs ("incretin mimetics") Lixisenatide (Lyxumia by Sanofi) exenatide (Byetta, Bydureon) liraglutide ... glucagon-like peptide-1 receptor agonists and dipeptidyl peptidase-4 inhibitors in type 2 diabetes". Lancet. 368 (9548): 1696- ... both GLP-1 and GIP are members of the glucagon peptide superfamily. "Many factors stimulate insulin secretion, but the main one ...
*  2-Oleoylglycerol
2OG has been shown to increase glucagon-like peptide-1 (GLP-1) and gastric inhibitory polypeptide (GIP) levels following ... 2-Arachidonoylglycerol JZL184 Dinh, T. P.; Carpenter, D.; Leslie, F. M.; Freund, T. F.; Katona, I.; Sensi, S. L.; Kathuria, S ... 2-Oleoylglycerol (2OG) is a monoacylglycerol that is found in biologic tissues. Its synthesis is derived from diacylglycerol ... "2-Oleoyl Glycerol is a GPR119 Agonist and Signals GLP-1 Release in Humans". Journal of Clinical Endocrinology & Metabolism. 96 ...
*  Amylin Pharmaceuticals
Garber, Alan J. (2011-05-01). "Long-Acting Glucagon-Like Peptide 1 Receptor Agonists". Diabetes Care. 34 (Supplement 2): S279- ... Exendin-4 is similar to the human gut hormone GLP-1, which is responsible for regulating insulin and glucagon release. Unlike ... "FDA Approves Symlin for Type 1 and Type 2 Diabetes". 2005-03-18. Retrieved 2017-05-26. "Dr. John Eng's Research Found That The ... But adult-onset type 2 diabetes affects far more people than type 1, and pramlintide showed significant benefits only at 6 ...
*  Neointimal hyperplasia
Exendin-4, a glucagon-like peptide-1 receptor (GLP-1) agonist used as drug treatment for type 2 diabetes inhibits neointimal ... a glucagon-like peptide-1 receptor agonist, attenuates neointimal hyperplasia after vascular injury. European Journal of ...
*  Liraglutide
... glucagon-like peptide-1 (GLP-1) that is used as a long-acting glucagon-like peptide-1 receptor agonist, binding to the same ... Liraglutide is a once-daily injectable derivative of the human incretin (metabolic hormone) glucagon-like peptide-1 (GLP-1), ... Liraglutide is an acylated glucagon-like peptide-1 (GLP-1) agonist, derived from human GLP-1-(7-37), a less common form of ... and suppressing prandial glucagon secretion. As of 2017 it is unclear if they affect a person's risk of death. In common to ...
*  Gastric inhibitory polypeptide
GIP, along with glucagon-like peptide-1 (GLP-1), belongs to a class of molecules referred to as incretins. GIP is derived from ... Thorens B (Dec 1995). "Glucagon-like peptide-1 and control of insulin secretion". Diabète & Métabolisme. 21 (5): 311-8. PMID ... It has traditionally been named gastrointestinal inhibitory peptide or gastric inhibitory peptide and was found to decrease the ... Gastric inhibitory polypeptide (GIP) or gastroinhibitory peptide, also known as the glucose-dependent insulinotropic peptide, ...
*  Glucagon receptor
"Tissue-specific and glucose-dependent expression of receptor genes for glucagon and glucagon-like peptide-1 (GLP-1)". Hormone ... The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family ... In humans, the glucagon receptor is encoded by the GCGR gene. Glucagon receptors are mainly expressed in liver and in kidney ... Furthermore, the structural dynamics of an active state complex of the Glucagon receptor, Glucagon, the Receptor activity- ...
*  Novo Nordisk
Ozempic® (semaglutide) is a once-weekly analogue of human glucagon-like peptide-1 (GLP-1) that has been developed for the ... Victoza - a long-acting glucagon-like peptide-1 receptor agonist, binding to the same receptors as does the endogenous ... Ryzodeg - a drug for type 1 and 2 diabetes. Ryzodeg is a soluble co-formulation of Tresiba and NovoRapid, and is a rapid-acting ... Tresiba - a Diabetes mellitus type 1 and Type 2 diabetes drug. It is a new-generation basal insulin with ultra-long duration of ...
*  GPR119
"GPR119 is required for physiological regulation of glucagon-like peptide-1 secretion but not for metabolic homeostasis". The ... 201 (2): 219-30. doi:10.1677/JOE-08-0453. PMID 19282326. Overton HA, Fyfe MC, Reynet C (Mar 2008). "GPR119, a novel G protein- ... Wu Y, Kuntz JD, Carpenter AJ, Fang J, Sauls HR, Gomez DJ, Ammala C, Xu Y, Hart S, Tadepalli S (Apr 2010). "2,5-Disubstituted ... Hansen KB, Rosenkilde MM, Knop FK, Wellner N, Diep TA, Rehfeld JF, Andersen UB, Holst JJ, Hansen HS (Sep 2011). "2-Oleoyl ...
*  Index of biochemistry articles
... peptide - peptide bond - peptide elongation factor - peptide elongation factor tu - peptide fragment - peptide initiation ... glucagon - glucagon receptor - glucocorticoid receptor - glucose - glutamate - glutamate receptor - Glutamic acid - Glutamine ... calcitonin gene-related peptide - calcitonin gene-related peptide receptor - calcitonin receptor - calcitriol receptor - ... vasoactive intestinal peptide - vasoactive intestinal peptide receptor - vasopressin - vasopressin receptor - venom - ...