Loading...
*  Ketotic hypoglycemia
... and glucagon injection elicits no rise of glucose. Once ketotic hypoglycemia is suspected and other conditions excluded, ... and release of glucagon, adrenaline, and other counterregulatory hormones. This shift of hormones initiates glycogenolysis and ...
*  Glucagon-like peptide 1 receptor
GLP1R binds glucagon-like peptide-1 (GLP1) and glucagon as its natural endogenous agonists. Receptor agonists: GLP-1 - ... "Crystal structure of glucagon-like peptide-1 in complex with the extracellular domain of the glucagon-like peptide-1 receptor ... The glucagon-like peptide 1 receptor (GLP1R) is a receptor protein found on beta cells of the pancreas. It is involved in the ... 2016). "Glucagon-Like Peptide-1 and Its Class B G Protein-Coupled Receptors: A Long March to Therapeutic Successes". Pharmacol ...
*  Glucagon rescue
... is the emergency injection of glucagon in case of severe diabetic hypoglycemia. It is needed during seizures ... "Glucagon for Injection, rDNA formulation" (PDF). Lilly. Retrieved 23 February 2014. "Stable liquid glucagon formulations for ... The glucagon rescue kit facilitates rapid rescue by a simple injection, which does not require medical expertise, and can be ... Glucagon will facilitate the release of stored glucose back into the bloodstream, raising the blood glucose level. Rescue has ...
*  Albiglutide
... (trade names Eperzan in Europe and Tanzeum in the US) is a glucagon-like peptide-1 agonist (GLP-1 agonist) drug ... 2008). "Glucagon-like Peptide-1 Analogs Other Than Exenatide". KEGG: Albiglutide. Matthew Herper for Forbes. 16 July 2012. ... Madsbad, S (2015). "Review of head‐to‐head comparisons of glucagon‐like peptide‐1 receptor agonists". Diabetes, Obesity & ... December 2008). "Pharmacodynamics, Pharmacokinetics, Safety, and Tolerability of Albiglutide, a Long-Acting Glucagon-Like ...
*  Glucagon
Excising the eyestalk in young crayfish produces glucagon-induced hyperglycemia. Glucagon binds to the glucagon receptor, a G ... have glucagon receptors. When glucagon binds to the glucagon receptors, the liver cells convert the glycogen into individual ... The pancreas releases glucagon when the concentration of glucose in the bloodstream falls too low. Glucagon causes the liver to ... They described glucagon in 1923. The amino acid sequence of glucagon was described in the late 1950s. A more complete ...
*  Glucagon (medication)
They described glucagon in 1923. The amino acid sequence of glucagon was described in the late 1950s. A more complete ... It is a manufactured form of the glucagon hormone. An injectable form of glucagon may be part of first aid in cases of low ... Glucagon binds to the glucagon receptor, a G protein-coupled receptor, located in the plasma membrane. The conformation change ... In this situation glucagon intravenously may be useful to treat their low blood pressure. Glucagon relaxes the lower esophageal ...
*  Glucagon receptor
The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family ... In humans, the glucagon receptor is encoded by the GCGR gene. Glucagon receptors are mainly expressed in liver and in kidney ... Furthermore, the structural dynamics of an active state complex of the Glucagon receptor, Glucagon, the Receptor activity- ... "Structure-function of the glucagon receptor family of G protein-coupled receptors: the glucagon, GIP, GLP-1, and GLP-2 ...
*  Glucagon receptor family
... glucagon, glucagon-like peptide-1, glucagon-like peptide-2) derived from the proglucagon polypeptide. The last receptor binds ... Glucagon receptor Glucagon-like peptide 1 receptor Glucagon-like peptide 2 receptor Gastric inhibitory polypeptide receptor The ... "Glucagon Receptors". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical Pharmacology. ... The glucagon receptor family is a group of closely related G-protein coupled receptors which include: ...
*  Glucagon-like peptide-2
... (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see ... Glucagon-like peptide 2 receptor Banting and Best Diabetes Centre at UT glp2. ... by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like ...
*  Glucagon-like peptide-1
Glucagon-like peptide 1 receptor Glucagon-like peptide-2 Type 2 diabetes GLP-1 analogs : exenatide, liraglutide, dulaglutide ... 2013). "Glucagon-like peptides 1 and 2 in health and disease: A review". Peptides. 44: 75-86. doi:10.1016/j.peptides.2013.01. ... Glucagon-like peptide-1 (GLP-1) is a 30 amino acid long peptide hormone deriving from the tissue-specific posttranslational ... 2016). "Glucagon-Like Peptide-1 and Its Class B G Protein-Coupled Receptors: A Long March to Therapeutic Successes". Pharmacol ...
*  Glucagon-like peptide receptor
Glucagon-like peptide 1 receptor (GLP-1R) - binds glucagon-like peptide 1 (GLP-1) Glucagon-like peptide 2 receptor (GLP-2R) - ... The glucagon-like peptide receptors (GLPRs) include the following two receptors: ... binds glucagon-like peptide 2 (GLP-2) Glucagon receptor. ...
*  Glucagon-like peptide 2 receptor
Like glucagon-like peptide-1 (GLP1) and glucagon itself, it is derived from the proglucagon peptide encoded by the GCG gene. ... "Entrez Gene: Glucagon-like peptide 2 receptor". Burrin DG, Petersen Y, Stoll B, Sangild P (Mar 2001). "Glucagon-like peptide 2 ... "Structure-function of the glucagon receptor family of G protein-coupled receptors: the glucagon, GIP, GLP-1, and GLP-2 ... Glucagon-like peptide 2 receptor (GLP-2R) is a protein that in human is encoded by the GLP2R gene located on chromosome 17. The ...
*  Glucagon-like peptide-1 receptor agonist
... s also known as GLP-1 receptor agonists or incretin mimetics are agonists of the GLP-1 ... Baggio LL (2008). "Glucagon-like Peptide-1 Analogs Other Than Exenatide". Medscape Diabetes & Endocrinology. Ali ES, Hua J, ... Wilson CH, Tallis GA, Zhou FH, Rychkov GY, Barritt GJ (2016). "The glucagon-like peptide-1 analogue exendin-4 reverses impaired ...
*  White adipose tissue
There is actually no evidence at present that glucagon has any effect on lipolysis in white adipose tissue. Glucagon is now ... It was previously thought that upon release of glucagon from the pancreas, glucagon receptors cause a phosphorylation cascade ... Gravholt, C H. "Physiological levels of glucagon do not influence lipolysis in abdominal adipose tissue as assessed by ... Lawrence, A. M. (1969). "Glucagon". Annual Review of Medicine. 20: 207-222. doi:10.1146/annurev.me.20.020169.001231. PMID ...
*  Gastric inhibitory polypeptide receptor
Together with glucagon-like peptide-1, GIP is largely responsible for the secretion of insulin after eating. It is involved in ... "Glucagon Receptor Family: GIP". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical ... Brubaker PL, Drucker DJ (2002). "Structure-function of the glucagon receptor family of G protein-coupled receptors: the ... glucagon, GIP, GLP-1, and GLP-2 receptors". Recept. Channels. 8 (3-4): 179-188. doi:10.1080/10606820213687. PMID 12529935. ...
*  Secretin family
... glucagon-like protein I, glucagon-like protein II, and glicentin. The structure of glucagon itself is fully conserved in all ... Glucagon/GIP/secretin/VIP hormones are a family of evolutionarily related peptide hormones that regulate activity of G-protein ... One such hormone, glucagon, is widely distributed and produced in the alpha-cells of pancreatic islets. It affects glucose ... Glucagon is produced, like other peptide hormones, as part of a larger precursor (preproglucagon), which is cleaved to produce ...
*  Glossary of diabetes
Insulin lowers the level of glucose (sugar) in the blood, whereas glucagon raises it. Glucagon is, therefore, an antagonist of ... Glucagon A hormone that raises the level of glucose (sugar) in the blood by forcing the liver to release some of its ... Insulin is a hormone as are glucagon, adrenaline, and angiotensin II. Human insulin Man-made insulins that is identical to the ... insulin and glucagon. Somogyi effect A swing to a high level of glucose (sugar) in the blood from an extremely low level, ...
*  DLK1
... negative correlation with glucagon expression". Histochemistry and Cell Biology. 106 (6): 535-42. doi:10.1007/BF02473268. PMID ...
*  Somatostatin
... inhibits insulin and glucagon secretion. Somatostatin has two active forms produced by alternative cleavage of a ... Inhibits the release of glucagon Suppresses the exocrine secretory action of pancreas. Octreotide (brand name Sandostatin, ... glucagon, and insulin than the natural hormone and has a much longer half-life (approximately 90 minutes, compared to 2-3 ...
*  Diabetic hypoglycemia
is developing the Glucagon Rescue Pen or G-Pen using a patented non-aqueous formulation of glucagon that is room-temperature ... Side effects of glucagon can include nausea and headache, but these can also occur after severe hypoglycemia even when glucagon ... The glucagon in the vial is a lyophilized pellet, which must be reconstituted with 1 mL of sterile water, included in the "kit ... Risks of glucagon use are far lower than risks of severe hypoglycemia, and it can usually produce a faster recovery than ...
*  Proglucagon
Glucagon Glucagon-like peptide 1 (GLP-1) Glucagon-like peptide 2 (GLP-2) Schroeder WT, Lopez LC, Harper ME, Saunders GF (1984 ... Proglucagon is a precursor of glucagon, and several other components. It is generated in the alpha cells of the pancreas and in ... White JW, Saunders GF (June 1986). "Structure of the human glucagon gene". Nucleic Acids Res. 14 (12): 4719-30. doi:10.1093/nar ... "Localization of the human glucagon gene (GCG) to chromosome segment 2q36-37". Cytogenet. Cell Genet. 38 (1): 76-9. doi:10.1159/ ...
*  Mladen Vranic
Diabetes reflects insulin deficiency and glucagon abundance. Vranic discovered extrapancreatic glucagon in dogs, which changed ... glucagon physiology, extrapancreatic glucagon, the role of the direct and indirect metabolic effects of insulin and the ... but he was the first to measure the physiological role of glucagon, based on the effect of glucagon on glucose turnover. In ... and provided conclusive evidence about the role of glucagon in diabetes. Before his research, glucagon was considered to have ...
*  Adrenergic receptor
induction of glucagon release from the pancreas. contraction of sphincters of the gastrointestinal tract negative feedback in ...
*  Carbohydrate metabolism
... is the most important factor determining the amount of glucagon or insulin produced. The release of glucagon is precipitated by ... Insulin and glucagon are the primary hormones involved in maintaining a steady level of glucose in the blood, and the release ... Glucagon in the liver stimulates glycogenolysis when the blood glucose is lowered, known as hypoglycemia. The glycogen in the ... Increased levels of glucagon activates the enzymes that catalyze glycogenolysis, and inhibits the enzymes that catalyze ...