Glucagon
Excising the eyestalk in young crayfish produces glucagon-induced hyperglycemia. Glucagon binds to the glucagon receptor, a G ... have glucagon receptors. When glucagon binds to the glucagon receptors, the liver cells convert the glycogen into individual ... The pancreas releases glucagon when the amount of glucose in the bloodstream is too low. Glucagon causes the liver to engage in ... Glucagon belongs to the secretin family of hormones. Glucagon is a 29-amino acid polypeptide. Its primary structure in humans ...
Glucagon receptor
The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family ... In humans, the glucagon receptor is encoded by the GCGR gene. Glucagon receptors are mainly expressed in liver and in kidney ... A glucagon receptor, upon binding with the signaling molecule glucagon, initiates a signal transduction pathway that begins ... Furthermore, the structural dynamics of an active state complex of the Glucagon receptor, Glucagon, the Receptor activity- ...
Glucagon (medication)
They described glucagon in 1923. The amino acid sequence of glucagon was described in the late 1950s. A more complete ... Glucagon binds to the glucagon receptor, a G protein-coupled receptor, located in the plasma membrane. The conformation change ... In this situation glucagon intravenously may be useful to treat their low blood pressure. Glucagon relaxes the lower esophageal ... Glucagon acts very quickly; common side-effects include headache and nausea. Drug interactions: Glucagon interacts only with ...
Glucagon rescue
... is the emergency injection of glucagon in case of severe diabetic hypoglycemia. It is needed during seizures ... Novo Nordisk manufactures the GlucaGen HypoKit and Eli Lilly and Company manufactures the Glucagon emergency kit. Glucagon must ... "Glucagon for Injection, rDNA formulation" (PDF). Lilly. Retrieved 23 February 2014. "Stable liquid glucagon formulations for ... The glucagon rescue kit facilitates rapid rescue by a simple injection, which does not require medical expertise, and can be ...
Glucagon receptor family
... glucagon, glucagon-like peptide-1, glucagon-like peptide-2) derived from the proglucagon polypeptide. The last receptor binds ... Glucagon receptor Glucagon-like peptide 1 receptor Glucagon-like peptide 2 receptor Gastric inhibitory polypeptide receptor The ... The glucagon receptor family is a group of closely related G-protein coupled receptors which include: ... "Glucagon Receptors". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical Pharmacology. ...
Glucagon-like peptide-1
Glucagon-like peptide 1 receptor Glucagon-like peptide-2 Type 2 diabetes GLP-1 analogs : exenatide, liraglutide, dulaglutide, ... Mojsov, S; Weir, G C; Habener, J F (1987-02-01). "Insulinotropin: glucagon-like peptide I (7-37) co-encoded in the glucagon ... Glucagon-like peptide-1 (GLP-1) is a 30- or 31-amino-acid-long peptide hormone deriving from the tissue-specific ... Glucagon-like peptide-1 receptor agonists gained approval as drugs to treat diabetes and obesity starting in the 2000s. ...
Glucagon-like peptide-2
Glucagon-like peptide 2 receptor Akita, Tomomi; Kimura, Ryosuke; Akaguma, Saki; Nagai, Mio; Nakao, Yusuke; Tsugane, Mamiko; ... Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see ... "Usefulness of cell-penetrating peptides and penetration accelerating sequence for nose-to-brain delivery of glucagon-like ... by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like ...
Glucagon-like peptide receptor
Glucagon-like peptide 2 receptor (GLP-2R) - binds glucagon-like peptide 2 (GLP-2) Glucagon receptor v t e (Articles lacking ... The glucagon-like peptide receptors (GLPRs) include the following two receptors: Glucagon-like peptide 1 receptor (GLP-1R) - ...
Glucagon-like peptide-2 receptor
Like glucagon-like peptide-1 (GLP1) and glucagon itself, it is derived from the proglucagon peptide encoded by the GCG gene. ... "Entrez Gene: Glucagon-like peptide 2 receptor". Burrin DG, Petersen Y, Stoll B, Sangild P (Mar 2001). "Glucagon-like peptide 2 ... Glucagon-like peptide-2 receptor (GLP-2R) is a protein that in human is encoded by the GLP2R gene located on chromosome 17. The ... Glucagon-Like Peptide-2 Receptor at the U.S. National Library of Medicine Medical Subject Headings (MeSH) This article ...
Glucagon-like peptide-1 receptor
GLP1R binds glucagon-like peptide-1 (GLP1) and glucagon as its natural endogenous agonists. Agonists: GLP-1 - endogenous in ... "Crystal structure of glucagon-like peptide-1 in complex with the extracellular domain of the glucagon-like peptide-1 receptor ... The glucagon-like peptide-1 receptor (GLP1R) is a receptor protein found on beta cells of the pancreas and on neurons of the ... Glucagon-like peptide-1 (GLP-1) is a hormone consisting of 30 amino acids. It is released by intestinal L cells when nutrients ...
Glucagon-like peptide-1 receptor agonist
... s, also known as GLP-1 receptor agonists (GLP-1-RA), incretin mimetics, or GLP-1 ... 1 April 2010). "Glucagon-like Peptide-1 receptor agonists activate rodent thyroid C-cells causing calcitonin release and C-cell ... Ali ES, Hua J, Wilson CH, Tallis GA, Zhou FH, Rychkov GY, Barritt GJ (September 2016). "The glucagon-like peptide-1 analogue ... Das A, Geetha KM, Hazarika I (29 August 2019). "Contemporary Updates on the Physiology of Glucagon like Peptide-1 and Its ...
White adipose tissue
There is actually no evidence at present that glucagon has any effect on lipolysis in white adipose tissue. Glucagon is now ... It was previously thought that upon release of glucagon from the pancreas, glucagon receptors cause a phosphorylation cascade ... Lawrence AM (1969). "Glucagon". Annual Review of Medicine. 20: 207-22. doi:10.1146/annurev.me.20.020169.001231. PMID 4893399. ... 4 (5). Gravholt CH, Møller N, Jensen MD, Christiansen JS, Schmitz O (May 2001). "Physiological levels of glucagon do not ...
G protein-coupled receptor
... glucagon; acetylcholine (muscarinic effect); chemokines; lipid mediators of inflammation (e.g., prostaglandins, prostanoids, ...
Pancreas
Delta cells in the islet also secrete somatostatin which decreases the release of insulin and glucagon. Glucagon acts to ... Glucagon release is stimulated by low blood glucose or insulin levels, and during exercise. Insulin acts to decrease blood ... This occurs around the third month of development, and insulin and glucagon can be detected in the human fetal circulation by ... The main factor influencing the secretion of insulin and glucagon are the levels of glucose in blood plasma. Low blood sugar ...
Christian de Duve
... but his rediscovery of glucagon confirmed his theses. In 1953 he experimentally demonstrated that glucagon did influence the ... The hormone glucagon was discovered by C.P. Kimball and John R. Murlin in 1923 as a hyperglycaemic (blood-sugar elevating) ... It was de Duve who realised that Sutherland's HG factor was in fact the same as glucagon; this rediscovery led to its permanent ... The biological importance of glucagon was not known and the name itself was essentially forgotten. It was a still a mystery at ...
Proglucagon
Glucagon (53-81) Glucagon-like peptide 1 (GLP-1, 92-128) - first seven residues further cleaved Glucagon-like peptide 2 (GLP-2 ... "Pro-glucagon". PDBe-KB Aggregated Views of Proteins. Wellcome Genome Campus, Hinxton, Cambridgeshire: EMBL-EBI. (Genes on human ... Proglucagon is a precursor of glucagon, and several other components. It is generated in the alpha cells of the pancreas and in ... Schroeder WT, Lopez LC, Harper ME, Saunders GF (1984). "Localization of the human glucagon gene (GCG) to chromosome segment ...
Pheochromocytoma
Hosseinnezhad A, Black RM, Aeddula NR, Adhikari D, Trivedi N (2011). "Glucagon-induced pheochromocytoma crisis". Endocrine ...
Gastric inhibitory polypeptide receptor
Together with glucagon-like peptide-1, GIP is largely responsible for the secretion of insulin after eating. It is involved in ... "Glucagon Receptor Family: GIP". IUPHAR Database of Receptors and Ion Channels. International Union of Basic and Clinical ... Brubaker PL, Drucker DJ (2002). "Structure-function of the glucagon receptor family of G protein-coupled receptors: the ... glucagon, GIP, GLP-1, and GLP-2 receptors". Recept. Channels. 8 (3-4): 179-188. doi:10.1080/10606820213687. PMID 12529935. ...
Secretin family
... glucagon-like protein I, glucagon-like protein II, and glicentin. The structure of glucagon itself is fully conserved in all ... One such hormone, glucagon, is widely distributed and produced in the alpha-cells of pancreatic islets. It affects glucose ... Glucagon is produced, like other peptide hormones, as part of a larger precursor (preproglucagon), which is cleaved to produce ... Glucagon/gastric inhibitory polypeptide/secretin/vasoactive intestinal peptide hormones are a family of evolutionarily related ...
Glossary of diabetes
Insulin lowers the level of glucose (sugar) in the blood, whereas glucagon raises it. Glucagon is, therefore, an antagonist of ... Glucagon A hormone that raises the level of glucose (sugar) in the blood by forcing the liver to release some of its ... Insulin is a hormone as are glucagon, adrenaline, and angiotensin II. Human insulin Man-made insulins that is identical to the ... insulin and glucagon. Somogyi effect A swing to a high level of glucose (sugar) in the blood from an extremely low level, ...
Cirrhosis
Glucagon is increased in cirrhosis. Vasoactive intestinal peptide is increased as blood is shunted into the intestinal system ...
DLK1
... negative correlation with glucagon expression". Histochemistry and Cell Biology. 106 (6): 535-42. doi:10.1007/BF02473268. PMID ...
Glucagonoma
Heightened glucagon secretion can be treated with the administration of octreotide, a somatostatin analog, which inhibits the ... Glucagonoma is a very rare tumor of the pancreatic alpha cells that results in the overproduction of the hormone, glucagon. ... Diabetes is not present in all cases of glucagonoma, but does frequently result from the insulin and glucagon imbalance. The ... When a person presents with a blood glucagon concentration greater than 500 mg/mL along with the glucagonoma syndrome, a ...
Somatostatin
Inhibits the release of glucagon Suppresses the exocrine secretory action of the pancreas Octreotide (brand name Sandostatin, ... Somatostatin inhibits insulin and glucagon secretion. Somatostatin has two active forms produced by the alternative cleavage of ... glucagon, and insulin than the natural hormone, and has a much longer half-life (about 90 minutes, compared to 2-3 minutes for ... including glucagon{{cite book}}: CS1 maint: location missing publisher (link) Costoff A. "Sect. 5, Ch. 4: Structure, Synthesis ...
Free fatty acid receptor 2
This stimules these cells to secrete GLP-1 (i.e., glucagon-like peptide-1) and PYY (i.e., peptide YY) into the blood. GLP-1 ... Since insulin causes cells to take up blood glucose and glucagon causes the liver to release glucose into the blood, FFAR2 ... also stimulates glucagon secretion; however, the net effect of GIP is to reduce blood glucose levels. GIP also slows gastric ... "Glucagon-like peptide 1 (GLP-1)". Molecular Metabolism. 30: 72-130. doi:10.1016/j.molmet.2019.09.010. PMC 6812410. PMID ...
Gluconeogenesis
Insulin counteracts glucagon by inhibiting gluconeogenesis. Type 2 diabetes is marked by excess glucagon and insulin resistance ... Global control of gluconeogenesis is mediated by glucagon (released when blood glucose is low); it triggers phosphorylation of ... Donkin SS, Armentano LE (February 1995). "Insulin and glucagon regulation of gluconeogenesis in preruminating and ruminating ... Compensatory induction of gluconeogenesis occurs in the kidneys and intestine, driven by glucagon, glucocorticoids, and ...
Beta-2 adrenergic receptor
Insulin and glucagon secretion from pancreas. Inhibit histamine-release from mast cells. Increase protein content of secretions ...
Glucose-elevating agent
Glucose (dextrose) Glucagon Diazoxide Huang, Qin; Bu, Shizhong; Yu, Yongwei; Guo, Zhiyong; Ghatnekar, Gautam; Bu, Min; Yang, ... and glucagon injections when severe hypoglycemia occurs. Diazoxide, which is used to counter hypoglycemia in disease states ... increases blood glucose and decreases insulin secretion and glucagon accelerates breakdown of glycogen in the liver ( ...
Sotalol
Fernandes CM, Daya MR (April 1995). "Sotalol-induced bradycardia reversed by glucagon". Canadian Family Physician. 41: 659-60, ...
Dasiglucagon
... operates through the same mechanism as endogenous glucagon, acting as an agonist at glucagon receptors expressed ... Binding to liver glucagon receptors, dasiglucagon activates Gsα and Gq, resulting in the activation of adenylate cyclase. This ... The time for patients to recover glycemic levels above 70 mg/dL was similar between dasiglucagon (≥0.3 mg) and glucagon (0.5 mg ... The glycokinetic response of dasiglucagon was 2-4 times higher than that of glucagon. Dasiglucagon had a higher overall effect ...