David S. Bredt
... links PSD-95 to the α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) subclass of glutamate receptors (Nature, 2000 ... spermidine/spermine N1-acetyltransferase (Nature Communications, 2020) and BARP (Cell Reports, 2019) that conspire with NACHO ...
Cystathionine beta synthase
The heme domain is composed of 70 amino acids and it appears that the heme only exists in mammalian CBS and is absent in yeast ... Isolation and molecular characterization of cystathionine beta-synthase and serine acetyltransferase from Trypanosoma". The ... The human enzyme cystathionine β-synthase is a tetramer and comprises 551 amino acids with a subunit molecular weight of 61 kDa ... Homocystinuria Cysteine Metabolism Amino acid S-Adenosyl-L-methionine Heme GRCh38: Ensembl release 89: ENSG00000160200 - ...
Histone methyltransferase
The catalytic domain of PRMTs consists of a SAM binding domain and substrate binding domain (about 310 amino acids in total). ... Histone-Modifying Enzymes Histone acetyltransferase (HAT) Histone deacetylase (HDAC) RNA polymerase control by chromatin ... composed of approximately 130 amino acids), the pre-SET, and the post-SET domains. The pre-SET and post-SET domains flank the ... Next, a nearby tyrosine residue deprotonates the ε-amino group of the lysine residue. The lysine chain then makes a ...
Severe cutaneous adverse reactions
i.e. altered to encode proteins with different amino acid sequences. Humans, it is estimated, express more than 10,000 ... Japanese individuals bearing slow acetylating variants of the N-acetyltransferase 2 gene, (NAT2), viz., NAT2*6A and NAT2*7B, ...
Epigenetics of diabetes Type 2
The lack of this amino acid prevents methylation from occurring, and as said above, hypomethylation leads to increased ... Histone acetyltransferases (HATs) and HDACs have been found to play key roles in genes linked to diabetes. One example is the ... 2010). "Deoxyribonucleic acid methylation and gene expression of PPARGC1A in human muscle is influenced by high-fat overfeeding ... the fatty acid-binding protein, aP2 and PPAR-γ2), demonstrating that miRNAs are also involved in fat metabolism and endocrine ...
Robert L. Last
... production and breakdown of essential amino acids, (2) the synthesis and protective roles of Vitamin C (ascorbic acid) and ... 2012). "Identification of a BAHD acetyltransferase that produces protective acyl sugars in tomato trichomes". Proc. Natl. Acad ... Gu, L (2010). "Metabolite profiling reveals broad metabolic phenotypes associated with a plant amino acid catabolism mutant". ... branched chain amino acid metabolic networks, and molecular genetic dissection of the Vitamins C and E biosynthetic pathways. ...
Phenylacetyl-CoA
... inhibits choline acetyltransferase acting as a neurotoxin. It competes with acetyl-CoA. PubChem. "Phenylacetyl ... amino]propanoylamino]ethyl] 2-phenylethanethioate. It is formed via the actions of Phenylacetate-CoA ligase. Phenylacetyl-CoA ... "Phenylacetyl-Coenzyme A Is the True Inducer of the Phenylacetic Acid Catabolism Pathway in Pseudomonas putida U". Applied and ... form of acetyl-CoA formed from the condensation of the thiol group from coenzyme A with the carboxyl group of phenylacetic acid ...
Expanded genetic code
... while the added amino acids are called non-standard amino acids (NSAAs), or unnatural amino acids (uAAs; term not used in ... where the plasmid is transferred into cells expressing chloramphenicol acetyl transferase with a premature amber codon. In the ... An amino acid auxotrophic expression host is supplemented with an amino acid analog during target protein expression. This ... Unnatural amino acids incorporated into proteins include heavy atom-containing amino acids to facilitate certain x-ray ...
Transfer DNA
The opines are amino acid derivatives used by the bacterium as a source of carbon and energy. This natural process of ... and phosphinothricin acetyltransferase (which acetylates and deactivates phosphinothricin, a potent inhibitor of glutamine ...
CLOCK
All other amino acids remained identical across native species, indicating that functional constraint may be another factor ... CLOCK exhibits histone acetyl transferase (HAT) activity, which is enhanced by dimerization with BMAL1. Dr. Paolo Sassone-Corsi ... The CLOCK-BMAL dimer has also been shown to activate reverse-erb receptor alpha (Rev-ErbA alpha) and retinoic acid orphan ... Doi M, Hirayama J, Sassone-Corsi P (May 2006). "Circadian regulator CLOCK is a histone acetyltransferase". Cell. 125 (3): 497- ...
NAD(P)H dehydrogenase (quinone 1)
"Collapse of the native structure caused by a single amino acid exchange in human NAD(P)H:quinone oxidoreductase". FEBS J. 281 ( ... quinone oxidoreductase and conjugation by acetyltransferases and sulfotransferases in human hepatic cytosols". Cancer Research ... is leading to an amino acid exchange on position 139 from arginine to tryptophane. Furthermore, an alternative RNA splicing ... carboxylation of specific glutamic acid residues in Gla‐factors/proteins (Gla domain) leading to their activation and ...
Acetyl-CoA
Degradation of branched-chain ketogenic amino acids such as valine, leucine, and isoleucine occurs. These amino acids are ... Choline, in combination with acetyl-CoA, is catalyzed by the enzyme choline acetyltransferase to produce acetylcholine and ... At low glucose levels, the production of acetyl-CoA is linked to β-oxidation of fatty acids. Fatty acids are first converted to ... Unlike free fatty acids, ketone bodies can cross the blood-brain barrier and are therefore available as fuel for the cells of ...
2-Amino-1-methyl-6-phenylimidazo(4,5-b)pyridine
PhIP is formed at high temperatures from the reaction between creatine or creatinine (found in muscle meats), amino acids, and ... and N-acetyltransferase 2 (NAT2), or by sulfotransferases. However, PhIP may also undergo a detoxification pathway through ... PhIP (2-Amino-1-methyl-6-phenylimidazo[4,5-b]pyridine) is one of the most abundant heterocyclic amines (HCAs) in cooked meat. ... a b International Agency for Research on Cancer (IARC) (1997) PhIP (2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine)(Group 2B ...
IKBKAP
... arginine is replaced by proline at position 696 in the IKAP protein's chain of amino acids (also written as Arg696Pro), or ... The RNA polymerase II holoenzyme constitutes partly of a multi-subunit histone acetyltransferase element known as the RNA ... researchers have identified other mutations that cause a change in amino acids (the building blocks of proteins). In these ...
C6orf163
The human C6orf163 protein is 329 amino acids long and has a molecular weight of 38 kDa. Its predicted isoelectric point is ... prediction of lysine acetyltransferase-specific modification sites from protein sequences". Scientific Reports. 6 (1): 39787. ... C6orf163 contains a predicted leucine zipper motif from amino acids 247 to 269. This motif is typically involved in DNA binding ... C6orf163 has a nuclear localization signal from amino acids 310 to 316. Antibody staining has shown C6orf163 to be localized to ...
UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
3-dideoxy-alpha-D-mannuronic acid). Westman EL, McNally DJ, Charchoglyan A, Brewer D, Field RA, Lam JS (May 2009). " ... UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase (EC 2.3.1.201, WbpD, WlbB) is an enzyme with systematic ... UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate+N-acetyltransferase at the U.S. National Library of Medicine Medical Subject ... name acetyl-CoA:UDP-2-acetamido-3-amino-2,3-dideoxy-alpha-D-glucuronate N-acetyltransferase. This enzyme catalyses the ...
Zinc finger protein 226
... there is a cysteine every three amino acids. At least one of the amino acids in between the C's are either aspartic acid or ... July 2005). "Histone acetyltransferase activity of p300 is required for transcriptional repression by the promyelocytic ... cysteine and histidine are the primary amino acids that bind to Zn2+ or nucleic acid, although other amino acids have been ... Despite the region's patterns of aspartic acid, it is still considered to have a lesser amount of the amino acid at 1.9%. There ...
Acetylserotonin O-methyltransferase
... has 350 amino acids and the amino acid sequence is: MCSQEGEGYSLLKEYANAFMVSQVLFAACELGVFELLAEALEPLDSAAVSSHLGSSPGD ... In 2001, it was argued that another enzyme in the pathway, N-acetyl transferase (NAT) was the limiting reagent in the ... 2006). "From genomics to chemical genomics: new developments in KEGG". Nucleic Acids Res. 34 (90001): D354-357. doi:10.1093/nar ... with 373 amino acids the sequence is: MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHG ...
Carnitine palmitoyltransferase II deficiency
This gene is composed of 5 exons that encode a protein 658 amino acids in length. To date, sixty disease-causing mutations ... 2003). "Structure of Human Carnitine Acetyltransferase: Molecular Basis For Fatty Acyl Transfer". J Biol Chem. 278 (15): 13159- ... The human homolog of the CPT II enzyme shows 82.2% amino acid sequence homology with the rat protein. Significant structural ... The majority of the genetic abnormalities in CPT II deficient patients affect amino acid residues somewhat removed from the ...
Hexosaminidase
... and a loop structure that forms from the amino acid sequence in the alpha subunit. The loop in the α subunit, consisting of Gly ... Toleman CA, Paterson AJ, Kudlow JE (February 2006). "The histone acetyltransferase NCOAT contains a zinc finger-like motif ... A glutamate residue (α Glu-323/β Glu-355) works as an acid by donating its hydrogen to the glycosidic oxygen atom on the GalNAc ... and arginine is essential for binding the N-acetyl-neuraminic acid residue of GM2 gangliosides. The GM2 activator protein ...
C4orf45
The C4orf45 protein produced from the most common mRNA transcript is 186 amino acids in length. Its theoretical isoelectric ... Deng W, Wang C, Zhang Y, Xu Y, Zhang S, Liu Z, Xue Y (December 2016). "GPS-PAIL: prediction of lysine acetyltransferase- ... Zhang J, Zhang S (June 2017). "Discovery of cancer common and specific driver gene sets". Nucleic Acids Research. 45 (10): e86 ...
FAM237A
Homo sapiens FAM237A contains two predicted fatty acid addition sites at amino acids 18 and 26; these sites overlap with one of ... prediction of lysine acetyltransferase-specific modification sites from protein sequences". Scientific Reports. 6 (1): 39787. ... Homo sapiens FAM237A amino acid composition is predicted to be relatively standard. It notably contains a repeat LFWD motif at ... amino acids 90 and 97. FAM237A's transmembrane domain is generally predicted to reside on amino acids 14-32 within the protein ...
Tabtoxin
Alpha-Amino acids, Amino acid derivatives, Bacterial toxins, Lactams, Azetidines). ... shape for substrate binding and contains the four motifs conserved in the GCN5-related N-acetyltransferase (GNAT) superfamily, ... The effects of carbon, nitrogen sources and amino acids on growth and tabtoxin production by pv. tabaci, were examined by ... Arai, Toshinobu; Arimura, Yasuhiro; Ishikura, Shun; Kino, Kuniki (15 August 2013). "l-Amino Acid Ligase from Pseudomonas ...
E3 binding protein
DNA-derived amino acid sequence, expression, and reconstitution of the pyruvate dehydrogenase complex". The Journal of ... "Facilitated interaction between the pyruvate dehydrogenase kinase isoform 2 and the dihydrolipoyl acetyltransferase". The ... is most likely due to the lack of conformational flexibility of the binding fragment of E3BP and the complementary amino acid ... Pyruvate dehydrogenase deficiency is characterized by the buildup of a chemical called lactic acid in the body and a variety of ...
Tubulin
β1-tubulin, sometimes called class VI β-tubulin, is the most divergent at the amino acid sequence level. It is expressed ... specially the one by α-tubulin N-acetyltransferase (ATAT1) which is being demonstrated to play an important role in many ...
H3S10P
The addition of a phosphate (PO43-) molecule to a non-polar R group of an amino acid residue can turn a hydrophobic portion of ... 61 It has been shown that phosphorylation of H3S10 promotes acetylation of H3K14 by the Gcn5 acetyltransferase in vitro and ... Ciesla J; Fraczyk T; Rode W (2011). "Phosphorylation of basic amino acid residues in proteins: important but easily missed". ... Phosphorylation introduces a charged and hydrophilic group in the side chain of amino acids, possibly changing a protein's ...
JADE1
The predicted 702-amino acid protein product of that clone was similar to the human zinc finger protein BR140 (BRPF1). Based on ... Havasi A, Haegele JA, Gall JM, Blackmon S, Ichimura T, Bonegio RG, Panchenko MV (January 2013). "Histone acetyl transferase ( ... Insertion of the vector into the third intron of the Jade1 gene lead to the production of a 47-amino-acid truncated protein. ... The protein product of that cDNA was given name JADE1 (Jade-1, PHF17). The deduced 509 amino acid long protein product of JADE1 ...
Glossary of genetics (0-L)
glucogenic amino acid Any amino acid that can be converted into glucose via gluconeogenesis, as opposed to the ketogenic amino ... notably the citric acid cycle. acetyltransferase acrocentric (of a linear chromosome or chromosome fragment) Having a ... ketogenesis ketogenic amino acid Any amino acid that can be converted directly into acetyl-CoA, which can then be oxidized for ... This is in contrast to the glucogenic amino acids, which can be converted into glucose. In humans, seven of the 20 amino acids ...
NPAS2
The predicted 824-amino acid human NPAS2 protein shares 87% sequence identity with mouse Npas2. The Npas2 gene has been found ... "Histone acetyltransferase-dependent chromatin remodeling and the vascular clock". The Journal of Biological Chemistry. 279 (8 ... Retinoic acid receptor alpha (RARα) and retinoid X receptor alpha (RXRα). In peripheral clocks, RARα and RXRα interact with ... This interaction depends upon humoral signaling by retinoic acid and serves to phase-shift the clock. Small heterodimer partner ...
Adenovirus early region 1A
These two proteins share almost the same internal sequences as shown in the figure except for the 46 internal amino acids ... Interaction of E1A with p300/CBP histone acetyltransferases causes a reduction in total cellular acetylation of H3K18 by ... The adenovirus early region 1A (E1A) 289R protein is composed of 289 amino acids, with four conserved regions: CR1 (42-80), CR2 ... all of which have been known to code for different proteins with varying numbers of amino acid residues of 289R, 243R, 217R, ...