Loading...
*  PLOS ONE: Taxonomic Classification of Bacterial 16S rRNA Genes Using Short Sequencing Reads: Evaluation of Effective Study...
As a result, high-throughout studies of microbial communities often do not sequence the entire 16S rRNA gene. The challenge is ... To assess precision and coverage of each design, we used a collection of ∼8,500 manually curated 16S rRNA gene sequences from ... We conclude that with a judicious selection of the sequenced region and the corresponding choice of a suitable training set for ... The typical approach is to perform high-throughout sequencing of 16S rRNA genes, which are then taxonomically classified based ...
http://journals.plos.org/plosone/article/related?id=10.1371/journal.pone.0053608
*  rpoB - DNA-directed RNA polymerase subunit beta - Bacillus anthracis - rpoB gene & protein
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as ... Sequence databases. Select the link destinations:. EMBL nucleotide sequence database. More...EMBLi. GenBank nucleotide sequence ... Protein interaction database and analysis system. More...IntActi. Q81VT8. 46 interactors.. ... PF04565. RNA_pol_Rpb2_3. 1 hit. PF10385. RNA_pol_Rpb2_45. 1 hit. PF00562. RNA_pol_Rpb2_6. 1 hit. PF04560. RNA_pol_Rpb2_7. 1 hit ...
http://www.uniprot.org/uniprot/Q81VT8
*  DNA-directed RNA polymerase I subunit RPA12
siRNA-based functional analysis showed that ZNRD1 down-regulation by siRNA or shRNA impaired HIV-1 replication at the ... AA Sequence MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPM 1 - 70 ... Component of RNA polymerase I which synthesizes ribosomal RNA precursors. This gene encodes a DNA-directed RNA polymerase I ... DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as ...
https://pharos.nih.gov/idg/targets/Q9P1U0
*  DNA-directed RNA interference - Wikipedia
This consists of a promoter sequence, driving expression of sense and antisense sequences separated by a loop sequence, ... Careful monitoring of potential toxicities in preclinical testing and analyses of pre-existing antibodies to gene therapy ... Any RNA, including endogenous mRNAs or viral RNAs, can be silenced by designing constructs to express double-stranded RNA ... Natural sequence variations can render a single shRNA-target site unrecognizable preventing RNA degradation. Multi-cassette ...
https://en.wikipedia.org/wiki/DNA-directed_RNA_interference
*  POLR2H - DNA-directed RNA polymerases I, II, and III subunit RPABC3 - Homo sapiens (Human) - POLR2H gene & protein
II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such ... DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as ... Sequence databases. Select the link destinations:. EMBL nucleotide sequence database. More...EMBLi. GenBank nucleotide sequence ... Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS], IDENTIFICATION ...
http://www.uniprot.org/uniprot/P52434
*  Negative-sense single-stranded RNA virus - Wikipedia
Through phylogenetic analysis, it was determined that NSV RNA polymerases share a common ancestor with other RNA polymerases ... and is dependent on the RNA sequence (i.e. poly(rA) is the most stable). An interesting finding is that specific sequences in ... The virus uses its own RNA replicase, also known as RNA-dependent RNA polymerase (RdRp), to form positive RNA template strands ... The negative viral RNA is complementary to the mRNA and must be converted to a positive RNA by RNA polymerase before ...
https://en.wikipedia.org/wiki/Negative-sense_single-stranded_RNA_virus
*  POLRMT - Wikipedia
2003). "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences". Proc. Natl. Acad. Sci ... Kravchenko JE, Rogozin IB, Koonin EV, Chumakov PM (2005). "Transcription of mammalian messenger RNAs by a nuclear RNA ... DNA-directed RNA polymerase, mitochondrial is an enzyme that in humans is encoded by the POLRMT gene. This gene encodes a ... 2004). "The DNA sequence and biology of human chromosome 19". Nature. 428 (6982): 529-35. doi:10.1038/nature02399. PMID ...
https://en.wikipedia.org/wiki/POLRMT
*  RNA Sequence Analysis of Single Cells by NGS - QIAGEN
QIAseq FX Single Cell RNA Library Kit Single cell RNA-seq libraries that provide a deeper view of the transcriptome Show ... Only on a single-cell level, can you eliminate the biological noise that is inherent to standard gene expression analysis - ... Get more powerful data from single cells - detect more transcripts with the same sequencing depth, including both mRNA and ... Our new solutions for single-cell RNA-seq deliver a deeper understanding of the transcriptome, providing new biological ...
https://www.qiagen.com/no/resources/knowledge-area/single-cell-resource/repli-g-rna-sequencing/
*  RNA-Sequencing Analysis of HepG2 Cells Treated with Atorvastatin
RNA-seq has proven to be a powerful technique for genome-wide splice variant analysis. In the present study, we sought to ... RNA-seq and exon array analyses were performed. The validation of selected genes was performed using Taqman gene expression ... RNA-seq analysis identified 121 genes and 98 specific splice variants, of which four were minor splice variants to be ... The IL21R transcript was detected to be differentially expressed via RNA-seq and RT-qPCR, but not in the exon array. In ...
https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0105836
*  Deep Sequencing Analysis of Small Noncoding RNA and mRNA Targets of the Global Post-Transcriptional Regulator, Hfq
We purified the epitope-tagged RNA-binding protein, Hfq, and its bound RNA by immunoprecipitation from the model pathogen, ... It will be valuable to scientists working on genetically tractable bacteria who are interested in the function of RNA-binding ... Author Summary The past decade has seen small regulatory RNA become an important new mediator of bacterial mRNA regulation. ... RNA sequencing Is the Subject Area "RNA sequencing" applicable to this article? Yes. No. ...
https://journals.plos.org/plosgenetics/article?id=10.1371/journal.pgen.1000163
*  Noncoding RNA gene detection using comparative sequence analysis | BMC Bioinformatics | Full Text
We describe a comparative sequence analysis algorithm for detecting novel structural RNA genes. The key idea is to test the ... Noncoding RNA gene sequences do not have strong statistical signals, unlike protein coding genes. A reliable general purpose ... A conserved coding region tends to show a pattern of synonymous substitutions, whereas a conserved structural RNA tends to show ... Noncoding RNA genes produce transcripts that exert their function without ever producing proteins. ...
https://bmcbioinformatics.biomedcentral.com/articles/10.1186/1471-2105-2-8
*  RNA Sequencing Analysis Reveals Interactions between Breast Cancer or Melanoma Cells and the Tissue Microenvironment during...
RNA Sequencing Analysis Reveals Interactions between Breast Cancer or Melanoma Cells and the Tissue Microenvironment during ... Y. Zhang, K. Chen, S. A. Sloan et al., "An RNA-sequencing transcriptome and splicing database of glia, neurons, and vascular ... J. M. Saunus, M. C. J. Quinn, A.-M. Patch et al., "Integrated genomic and transcriptomic analysis of human brain metastases ... C. Trapnell, L. Pachter, and S. L. Salzberg, "TopHat: discovering splice junctions with RNA-Seq," Bioinformatics, vol. 25, no. ...
https://www.hindawi.com/journals/bmri/2017/8032910/ref/
*  The American Journal of Tropical Medicine and Hygiene | Sequence analysis of the small RNA segment of guinea pig-passaged...
We have compared the nucleotide sequences of the small RNA segments of two attenuated, low-passage variants of the PIC virus ... f Sequence analysis of the small RNA segment of guinea pig-passaged Pichinde virus variants. * Authors: L Zhang, K Marriott, J ... We have compared the nucleotide sequences of the small RNA segments of two attenuated, low-passage variants of the PIC virus ...
http://www.ajtmh.org/content/journals/10.4269/ajtmh.1999.61.220
*  Third-generation RNA-sequencing analysis: graph alignment and transcript assembly with long reads
A common analysis workflow of RNA-sequencing (RNA-seq) data consists of mapping the sequencing reads to a reference genome, ... Third-generation RNA-sequencing analysis: graph alignment and transcript assembly with long reads. Visa fullständig post ... Third-generation RNA-sequencing analysis: graph alignment and transcript assembly with long reads. ... The first part of this thesis focuses on the analysis of short-read RNA-seq data. As short-read mapping is an already well- ...
https://helda.helsinki.fi/handle/10138/228812?locale-attribute=sv
*  Abstract W P73: Feasibility and Preliminary Results of Whole Blood RNA-Sequencing Analysis in Patients With Intracranial...
Abstract W P73: Feasibility and Preliminary Results of Whole Blood RNA-Sequencing Analysis in Patients With Intracranial ... Abstract W P73: Feasibility and Preliminary Results of Whole Blood RNA-Sequencing Analysis in Patients With Intracranial ... Abstract W P73: Feasibility and Preliminary Results of Whole Blood RNA-Sequencing Analysis in Patients With Intracranial ... Abstract W P73: Feasibility and Preliminary Results of Whole Blood RNA-Sequencing Analysis in Patients With Intracranial ...
http://stroke.ahajournals.org/content/45/Suppl_1/AWP73
*  Sequence Analysis of In Vivo Defective Interfering-Like RNA of Influenza A H1N1 Pandemic Virus | Journal of Virology
The top sequence is the reference (REF) sequence, whereas the remaining sequences are the cloned PB2 subgenomic RNAs of ... Sequence Analysis of In Vivo Defective Interfering-Like RNA of Influenza A H1N1 Pandemic Virus. Kazima Saira, Xudong Lin, Jay V ... Complete sequence analyses show that two defective interfering influenza viral RNAs contain a single internal deletion of a ... Sequencing and analysis.Viral RNA was extracted from nasopharyngeal specimens and amplified by multisegment reverse ...
https://jvi.asm.org/content/87/14/8064
*  Sequence Analysis, RNA | Colorado PROFILES
"Sequence Analysis, RNA" by people in this website by year, and whether "Sequence Analysis, RNA" was a major or minor topic of ... "Sequence Analysis, RNA" is a descriptor in the National Library of Medicine's controlled vocabulary thesaurus, MeSH (Medical ... Sequence Analysis, RNA*Sequence Analysis, RNA. *Analyses, RNA Sequence. *RNA Sequence Analyses ... A multistage process that includes cloning, physical mapping, subcloning, sequencing, and information analysis of an RNA ...
https://profiles.ucdenver.edu/display/198543
*  RNA sequencing analysis identifies novel spliced transcripts but does not indicate quantitative or qualitative changes of viral...
Using this model, we compared the transcriptional patterns of CRPV in papillomas and carcinomas by RNA sequencing (RNA-seq). ... Neither RNA-seq nor quantitative real-time PCR-based assays identified qualitative or quantitative changes of viral ... In summary, our analyses confirmed that papillomaviruses have highly similar transcriptional patterns, but they do not suggest ... RNA sequencing analysis identifies novel spliced transcripts but does not indicate quantitative or qualitative changes of viral ...
https://www.semanticscholar.org/paper/RNA-sequencing-analysis-identifies-novel-spliced-or-Probst-Hunczek-J%C3%A4ger/bc85cb94861befb0c0081c6c38eddd8919ee7c80
*  RNA-binding protein data | Sequence analysis - OMICtools
RNA splicing and processing, localization, stability and translation (Licatalosi and Darnell, 2010; McKee and Silver, 2007; ... RNA-binding proteins (RBPs) have a fundamental role in a wide variety of cellular processes including transcription, ... NMR-based proteomics analysis 1 RNA-seq analysis 1 BS-seq analysis 1 Metagenomic sequencing analysis 1 ... RNA-binding protein databases , Sequence analysis. RNA-binding proteins (RBPs) have a fundamental role in a wide variety of ...
https://omictools.com/rna-binding-protein-data-category
*  Efficient cellular fractionation improves RNA sequencing analysis of mature and nascent transcripts from human tissues | BMC...
RNA-seq) studies is usually total RNA or polyA+ RNA. Both forms of RNA represent heterogeneous pools of RNA molecules at ... Thus, RNA-seq of separated cytosolic and nuclear RNA can significantly improve the analysis of complex transcriptomes from ... In comparison with conventional polyA+ RNA, the cytoplasmic RNA contains a significantly higher fraction of exonic sequence, ... the nuclear fraction shows an enrichment of unprocessed RNA compared with total RNA-seq, making it suitable for analysis of ...
https://bmcbiotechnol.biomedcentral.com/articles/10.1186/1472-6750-13-99
*  League of Reason • View topic - Mindboggling result of Ribosomal RNA sequence analysis
Mindboggling result of Ribosomal RNA sequence analysis. Page 1 of 14. [ 270 posts ] 1, 2, 3, 4, 5 ... 14 Next ... Re: Mindboggling result of Ribosomal RNA sequence analysis. Bernhard.visscher wrote:. Life is eternal. That is the answer.. ... Re: Mindboggling result of Ribosomal RNA sequence analysis. Sparhafoc wrote:. I think LEROY should be banned - he lies about ... Re: Mindboggling result of Ribosomal RNA sequence analysis. Greetings,. Rumraket wrote:. Sparhafoc wrote:. I think LEROY should ...
http://theleagueofreason.co.uk/viewtopic.php?f=8&t=14780
*  RNA Sequencing Analysis of Intracranial Aneurysm Walls Reveals Involvement of Lysosomes and Immunoglobulins in Rupture
... DSpace/ ... Methods - We determined expression levels with RNA sequencing. Applying ... read more a multivariate negative binomial model, ... Pathway analysis was used to identify enriched pathways. We also analyzed genes with an extreme pattern of differential ...
https://dspace.library.uu.nl/handle/1874/342483
*  Detection and sequence analysis of borna disease virus p24 RNA...
Detection and sequence analysis of borna disease virus p24 RNA from peripheral blood mononuclear cells of patients with mood ... Sequence analysis of BDV p24 RNA from the PBMCs of patients and blood donors showed a high nucleotide sequence conservation but ... Detection and sequence analysis of borna disease virus p24 RNA from peripheral blood mononuclear cells of patients with mood ... definite nucleotide mutations compared with horse BDV p24 RNA sequences. In comparison with human BDV p24 RNA sequences ...
https://www.mysciencework.com/publication/show/detection-sequence-analysis-borna-disease-virus-p24-rna-from-peripheral-blood-mononuclear-cells-patients-mood-disorders-e911b1f9
*  Alterations of microRNA and microRNA-regulated messenger RNA expression in germinal center B-cell lymphomas determined by...
Comprehensive miRNA sequence analysis reveals survival differences in diffuse large B-cell lymphoma patients. Genome Biol. 2015 ... Purified RNA fragments are reverse transcribed and cDNA libraries are sequenced on a HiSeq2500 followed by bioinformatic ... After protein digestion, sequencing adapters were ligated to the purified RNA fragments. Following reverse transcription, PAR- ... We here report a deep sequencing analysis to identify differences in miRNA expression in samples from patients with BL, FL and ...
http://www.haematologica.org/content/101/11/1380?ijkey=e2670b8cb63dfb33290bb7e9063b39dad2ec5fe0&keytype2=tf_ipsecsha
*  Preparation of cDNA libraries for high-throughput RNA sequencing analysis of RNA 5' ends | Dr. Bryce E. Nickels
Preparation of cDNA libraries for high-throughput RNA sequencing analysis of RNA 5' ends. Vvedenskaya, IO, Goldman SR, Nickels ... Preparation of cDNA libraries for high-throughput RNA sequencing analysis of RNA 5' ends. Methods Mol Biol. 1276:211-228.. ... Interactions between RNA polymerase and the core recognition element are a determinant of transcription start site selection.. ... The mechanism of RNA 5′ capping with NAD+, NADH, and desphospho-CoA. Nature. 535(7612):444-447. ...
https://www.waksman.rutgers.edu/nickels/publications/preparation-cdna-libraries-high-throughput-rna-sequencing-analysis-rna-5-ends