We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their ... InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites ... GO:0004672 protein kinase activity GO:0004713 protein tyrosine kinase activity GO:0004714 transmembrane receptor protein ... GO:0006468 protein phosphorylation GO:0007169 transmembrane receptor protein tyrosine kinase signaling pathway ...
... and ProteinsProteinsIntracellular Signaling Peptides and ProteinsMAP Kinase Kinase Kinasesraf KinasesProto-Oncogene Proteins A- ... Proto-Oncogene Proteins A-raf. A raf kinase subclass expressed primarily in non-neuronal tissues such as SKELETAL MUSCLE. The A ... Proto-Oncogene Proteins c-raf (1989-2004). All MeSH CategoriesChemicals and Drugs CategoryAmino Acids, Peptides, ... Proteins A-raf, Proto-Oncogene. *Proto Oncogene Proteins A raf. *A-raf Protein Kinase ...
... and ProteinsProteinsNeoplasm ProteinsOncogene ProteinsProto-Oncogene ProteinsProto-Oncogene Proteins c-bcl-6 ... and ProteinsProteinsDNA-Binding ProteinsProto-Oncogene Proteins c-bcl-6 ... and ProteinsProteinsTranscription FactorsProto-Oncogene Proteins c-bcl-6 ... Proto-Oncogene Proteins c-bcl-6. A DNA-binding protein that contains an N-terminal BTB (POZ) DOMAIN and C-terminal CYS2-HIS2 ...
Proto-oncogene tyrosine-protein kinase Src, also known as proto-oncogene c-Src or simply c-Src , is a non-receptor tyrosine ... This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this ... Src (pronounced "sarc" as it is short for sarcoma) is a proto-oncogene encoding a tyrosine kinase originally discovered by J. ... This protein phosphorylates specific tyrosine residues in other proteins. An elevated level of activity of c-Src tyrosine ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex ... This protein in other organisms (by gene name): P01106 - Homo sapiens 10 * A8WFE7 - Homo sapiens no matching PDB entries ... Protein disorder predictions are based on JRONN (Troshin, P. and Barton, G. J. unpublished), a Java implementation of RONN * ... The Protein Feature View requires a browser that supports SVG (Scalable Vector Graphics). Mouse over tracks and labels for more ...
Myc proto-oncogene protein. Details. Name. Myc proto-oncogene protein. Kind. protein. Organism. Humans. Polypeptides. Name. ... Myc proto-oncogene protein. P01106. Details. Drug Relations. Drug Relations. DrugBank ID. Name. Drug group. Pharmacological ...
Genomes and Genes about proto oncogene proteins c myc ... proteins , dna binding proteins , proto oncogene proteins c myc ... proto oncogene proteins c myc. Summary. Summary: Cellular DNA-binding proteins encoded by the c-myc genes. They are normally ... proto oncogene proteins c bcl 2*cell cycle*cultured tumor cells*genetic transcription*neoplastic cell transformation*gene ... cell cycle proteins*nuclear proteins*reverse transcriptase polymerase chain reaction*biological tumor markers*transfection*gene ...
Proto-oncogene vavAdd BLAST. 845. Amino acid modifications. Feature key. Position(s). DescriptionActions. Graphical view. ... to allow unambiguous identification of a protein.,p>,a href=/help/protein_names target=_top>More...,/a>,/p>Protein namesi. ... Proto-oncogene. ,p>This section describes post-translational modifications (PTMs) and/or processing events.,p>,a href=/help/ ... Pfam protein domain database. More...Pfami. View protein in Pfam. PF00130 C1_1, 1 hit. PF11971 CAMSAP_CH, 1 hit. PF00169 PH ...
Protein-protein interaction databases. STRING: functional protein association networks. More...STRINGi. 9913.ENSBTAP00000055845 ... Protein-protein interaction databases. STRING: functional protein association networks. More...STRINGi. 9913.ENSBTAP00000055845 ... Protein predictedi ,p>This indicates the type of evidence that supports the existence of the protein. Note that the protein ... to allow unambiguous identification of a protein.,p>,a href=/help/protein_names target=_top>More...,/a>,/p>Protein namesi. ...
A Cell Number Counting Factor Regulates Akt/Protein Kinase B To Regulate Dictyostelium discoideum Group Size Tong Gao, David ...
Products of proto-oncogenes. Normally they do not have oncogenic or transforming properties, but are involved in the regulation ... Proto Oncogene Proteins; Proto-Oncogene Proteins, Cellular; c onc Proteins; Cellular Proto-Oncogene Proteins; c-onc Proteins ... Proto Oncogene Proteins, Cellular; Proto-Oncogene Products, Cellular; Cellular Proto Oncogene Proteins; Cellular Proto-Oncogene ... Proto-Oncogene Proteins. Subscribe to New Research on Proto-Oncogene Proteins Products of proto-oncogenes. Normally they do not ...
The Hepatitis C Virus Core Protein Contains a BH3 Domain That Regulates Apoptosis through Specific Interaction with Human Mcl-1 ... Induces the Nucleolar Targeting of the Kaposis Sarcoma-Associated Herpesvirus KS-Bcl-2 Protein Inna Kalt, Tatyana Borodianskiy ...
Proto-oncogene tyrosine-protein kinase Src, also known as proto-oncogene c-Src or simply c-Src , is a non-receptor tyrosine ... This proto-oncogene may play a role in the regulation of embryonic development and cell growth. ... This proto-oncogene may play a role in the regulation of embryonic development and cell growth. ... This protein phosphorylates specific tyrosine residues in other proteins. c-Src stands for "cellular Src kinase" and should not ...
Up-regulation of the angiotensin II type 1 receptor by the MAS proto-oncogene is due to constitutive activation of Gq/G11 by ... The MAS proto-oncogene is not imprinted in humans. Riesewijk, A.M., Schepens, M.T., Mariman, E.M., Ropers, H.H., Kalscheuer, V. ... Cell type-specific expression of the Mas proto-oncogene in testis. Alenina, N., Baranova, T., Smirnow, E., Bader, M., Lippoldt ... The mammalian proto-oncogene MAS has been identified as a novel neuronal angiotensin receptor, which responds preferentially to ...
Ras-related protein Ral-B, RALB.. Introduction. Ras-related protein Ral-B (RALB) is a member of a subfamily of Ras-related ... For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).. Avoid multiple freeze-thaw cycles. ... RALB is activated by a unique nucleotide exchange factor, Ral GDS, and deactivated by a distinct GTPase-activating protein. ...
E3 ubiquitin protein ligase L homeolog Antibody Products from leading suppliers on Biocompare. View specifications, prices, ... Anti-Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase L homeolog Antibody Products. Clear ... Anti-Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase L homeolog Antibody Products. ... Anti-Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase L homeolog Antibody Products. ...
Proto-oncogene tyrosine-protein kinase MER. A, B, C, D. 313. Homo sapiens. Mutation(s): 0 Gene Names: MERTK, MER. EC: 2.7.10.1 ... Crystal structure of catalytic domain of the proto-oncogene tyrosine-protein kinase MER in complex with inhibitor C52. *DOI: ... Although Mer adaptor proteins and signaling pathways have been identified, it remains unclear how Mer initiates phagocytosis. ... The mammalian ortholog of the retroviral oncogene v-Eyk, and a receptor tyrosine kinase upstream of antiapoptotic and ...
Browsing by Subject "Proto-Oncogene Proteins c-kit". 0-9. A. B. C. D. E. F. G. H. I. J. K. L. M. N. O. P. Q. R. S. T. U. V. W. ...
The serine/threonine protein kinase encoded by the Akt proto-oncogene is catalytically inactive in serum-starved primary and ... The protein kinase encoded by the Akt proto-oncogene is a target of the PDGF-activated phosphatidylinositol 3-kinase Cell. 1995 ... The serine/threonine protein kinase encoded by the Akt proto-oncogene is catalytically inactive in serum-starved primary and ... Proto-Oncogene Proteins / drug effects * Proto-Oncogene Proteins / metabolism* * Proto-Oncogene Proteins c-akt ...
Showing Protein Proto-oncogene tyrosine-protein kinase Yes (HMDBP01230). IdentificationBiological propertiesGene properties ... Protein Sequence. ,Proto-oncogene tyrosine-protein kinase Yes MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMT ... Involved in protein kinase activity. Specific Function. Promotes infectivity of Neisseria gonorrhoeae in epithelial cells by ... Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by ...
Showing Protein Proto-oncogene tyrosine-protein kinase Src (HMDBP01147). IdentificationBiological propertiesGene properties ... Protein Sequence. ,Proto-oncogene tyrosine-protein kinase Src MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE ... Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by ... Franco M, Furstoss O, Simon V, Benistant C, Hong WJ, Roche S: The adaptor protein Tom1L1 is a negative regulator of Src ...
Proto Oncogene Tyrosine Protein Kinase ROS {Proto Oncogene c Ros 1 or Receptor Tyrosine Kinase c Ros ... Proto Oncogene Tyrosine Protein Kinase ROS (Proto Oncogene c Ros 1 or Receptor Tyrosine Kinase c Ros Oncogene 1 or c Ros ... Proto Oncogene Tyrosine Protein Kinase ROS (Proto Oncogene c Ros 1 or Receptor Tyrosine Kinase c Ros Oncogene 1 or c Ros ... 872037-proto-oncogene-tyrosine-protein-kinase-ros-proto-oncogene-c-ros-1-or-receptor-tyrosine-kinase-c-ros-oncogene-1-or-c-ros- ...
Alternative Splicing of the Cyclin D1 Proto-Oncogene Is Regulated by the RNA-Binding Protein Sam68. Maria Paola Paronetto, ... Alternative Splicing of the Cyclin D1 Proto-Oncogene Is Regulated by the RNA-Binding Protein Sam68 ... Alternative Splicing of the Cyclin D1 Proto-Oncogene Is Regulated by the RNA-Binding Protein Sam68 ... Alternative Splicing of the Cyclin D1 Proto-Oncogene Is Regulated by the RNA-Binding Protein Sam68 ...
In this report, the global RAF Proto Oncogene Serine/Threonine... ... 108 Pages Report] Check for Discount on Global RAF Proto ... Oncogene Serine/Threonine Protein Kinase Market Research Report 2018 report by QYResearch Group. ... Figure Picture of RAF Proto Oncogene Serine/Threonine Protein Kinase. Figure Global RAF Proto Oncogene Serine/Threonine Protein ... of RAF Proto Oncogene Serine/Threonine Protein Kinase (2013-2025). 1.5.1 Global RAF Proto Oncogene Serine/Threonine Protein ...
"Proto-Oncogene Proteins c-rel" by people in this website by year, and whether "Proto-Oncogene Proteins c-rel" was a major or ... "Proto-Oncogene Proteins c-rel" is a descriptor in the National Library of Medicines controlled vocabulary thesaurus, MeSH ( ... Proto-Oncogene Proteins c-rel*Proto-Oncogene Proteins c-rel. *Proto Oncogene Proteins c rel ... Below are the most recent publications written about "Proto-Oncogene Proteins c-rel" by people in Profiles. ...