Loading...
*  Analysis of Protein Kinase Domain and Tyrosine Kinase or Serine/Threonine Kinase signatures Involved In Lung Cancer [PeerJ...
Tyrosine Protein kinases and Serine/Threonine Protein Kinases are the two broad classes of protein kinases in accordance to ... The study of Tyrosine protein kinase and serine Kinase coding regions have the importance of sequence and structure ... The results of this study revealed that the presence of Protein Kinase Domain and Tyrosine or Serine/Threonine Kinase ... Frequent mutations in Protein Kinase Domain alter the process of phosphorylation which results in abnormality in regulations of ...
https://peerj.com/preprints/414/
*  OriGene - Search All Products
Protein. Recombinant protein of human lymphocyte-specific protein tyrosine kinase (LCK), transcript variant 2 $680. In Stock. ... LCK (untagged)-Kinase deficient mutant (K273M) of Human lymphocyte-specific protein tyrosine kinase (LCK), transcript variant 2 ... Lenti ORF clone of Human lymphocyte-specific protein tyrosine kinase (LCK), transcript variant 2, mGFP tagged $900. 2-3 weeks. ... Lenti ORF clone of Human lymphocyte-specific protein tyrosine kinase (LCK), transcript variant 2, mGFP tagged $900. 3-4 weeks. ...
http://www.origene.com/cdna/search-nm.aspx?accn=NM_005356&species=Human&product=ALL
*  Oncogenic protein tyrosine kinases | SpringerLink
Signals through Kit receptor tyrosine kinase are essential for development of erythrocytes, melanocytes, germ cells, mast cells ... Signals through Kit receptor tyrosine kinase are essential for development of erythrocytes, melanocytes, germ cells, mast cells ...
https://link.springer.com/article/10.1007%2Fs00018-004-4273-y
*  Patent US7585866 - Protein tyrosine kinase inhibitors - Google Patents
... and methods of using them to treat tyrosine kinase-dependent diseases and conditions in mammals: wherein n is an integer, ... regulate and/or modulate tyrosine kinase signal transduction, compositions which contain these compounds, ... Protein tyrosine kinase inhibitors. US20090298855 *. Jul 28, 2009. Dec 3, 2009. Critical Outcome Technologies Inc.. Protein ... Tyrosine kinases can be categorized as receptor type or non-receptor type. Receptor type tyrosine kinases have an extracellular ...
http://www.google.com/patents/US7585866?dq=6859936
*  Tyrosine kinase - Protein Tyrosine Kinases
Tyrosine kinase inhibitor Tyrosine-kinase inhibitor is a pharmaceutical drug that inhibits tyrosine kinases. Tyrosine kinases ... p210 tyrosine kinase inhibitor Tyrphostin AG 957 is a potent tyrosine kinase inhibitor. Selectively blocks the tyrosine kinase ... tyrosine kinase inhibitor AG-1288 is a tyrosine kinase inhibitor. Has been shown in human amnion cells (IC50 =21 mM) to block ... High Purity Kinase Inhibitors on Signaling Pathways. Trusted by 10,000+ Scientists since 2006 Search. ...
https://www.adooq.com/tyrosine-kinase.html
*  Ephrin Receptor - Protein Tyrosine Kinases
ALW-II-41-27 is a novel Eph receptor tyrosine kinase inhibitor. ... High Purity Kinase Inhibitors on Signaling Pathways. Trusted by ...
https://www.adooq.com/ephrin-receptor.html
*  TYRO3 (TYRO3 protein tyrosine kinase)
TYRO3 protein tyrosine kinase), Authors: Kristen M Jacobsen, Rachel MA Linger, Douglas K Graham. Published in: Atlas Genet ... tyrosine kinase activity transmembrane receptor protein tyrosine kinase activity transmembrane receptor protein tyrosine kinase ... tyrosine kinase activity transmembrane receptor protein tyrosine kinase activity transmembrane receptor protein tyrosine kinase ... FN3 (PS50853) IG_LIKE (PS50835) PROTEIN_KINASE_ATP (PS00107) PROTEIN_KINASE_DOM (PS50011) PROTEIN_KINASE_TYR (PS00109) ...
http://atlasgeneticsoncology.org/Genes/GC_TYRO3.html
*  Protein tyrosine kinase inhibitors - Patent # 8252800 - PatentGenius
... treat tyrosine kinase-dependent diseases and conditions in mammals: ##STR00001## wherein n is an integer, preferably n is 1; ... regulate and/or modulate tyrosine kinase signal transduction, compositions which contain these compounds, and methods of using ... Tyrosine kinases can be categorized as receptor type or non-receptor type. Receptor type tyrosine kinases have an extracellular ... For example, the Bcr-Abl tyrosine kinase is the constitutiveabnormal tyrosine kinase created by the Philadelphia chromosome ...
http://www.patentgenius.com/patent/8252800.html
*  PTK2B protein tyrosine kinase 2 beta [Homo sapiens (human)] - Gene - NCBI
protein-tyrosine kinase 2-beta. Names. CAK-beta. FADK 2. PTK2B protein tyrosine kinase 2 beta. calcium-dependent tyrosine ... focal adhesion kinase 2. proline-rich tyrosine kinase 2. protein kinase B. related adhesion focal tyrosine kinase. NP_004094.3 ... PTK2B protein tyrosine kinase 2 beta [Homo sapiens] PTK2B protein tyrosine kinase 2 beta [Homo sapiens]. Gene ID:2185 ... Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase. smart00219. Location:425 → 679. TyrKc; Tyrosine kinase ...
https://www.ncbi.nlm.nih.gov/gene/2185
*  Protein Tyrosine Kinase and Phosphatase Expression Profiling - Cancer Research | Sigma-Aldrich
Tyrosine kinases (PTK) represent only 10% of all protein kinases, although they are the most important protein kinases. PTKs ... 1998) Protein-tyrosine kinase and protein-serine/threonine kinase expression in human gastric cancer cell lines. J. Biomed. Sci ... Protein Tyrosine Kinase and Phosphatase Expression Profiling in Human Cancers. Wen-Chang Lin. Institute of Biomedical Sciences ... Robinson, D.R., Wu, Y.M., and Lin, S.F. (2000) The protein tyrosine kinase family of the human genome. Oncogene 19, 5548-5557. ...
https://www.sigmaaldrich.com/life-science/cell-biology/cancer-research/learning-center/cancer-research-protocols/ptk-ptp-expression.html
*  Protein Tyrosine Kinase-6 (PTK6) | Springer for Research & Development
The intracellular protein tyrosine kinase, PTK6 (also known as the breast tumor kinase, Brk), has been implicated in the ... Breast tumor kinase (protein tyrosine kinase 6) regulates heregulin-induced activation of ERK5 and p38 MAP kinases in breast ... The intracellular protein tyrosine kinase, PTK6 (also known as the breast tumor kinase, Brk), has been implicated in the ... PTK (protein tyrosine kinase)-6 and HER2 and 4, but not HER1 and 3 predict long-term survival in breast carcinomas. Br J Cancer ...
https://rd.springer.com/referenceworkentry/10.1007/978-1-4419-0461-4_305?page
*  Protein Tyrosine Kinase-6 (PTK6) | Springer for Research & Development
The intracellular protein tyrosine kinase, PTK6 (also known as the breast tumor kinase, Brk), has been implicated in the ... Breast tumor kinase (protein tyrosine kinase 6) regulates heregulin-induced activation of ERK5 and p38 MAP kinases in breast ... The intracellular protein tyrosine kinase, PTK6 (also known as the breast tumor kinase, Brk), has been implicated in the ... Harvey A. (2018) Protein Tyrosine Kinase-6 (PTK6). In: Choi S. (eds) Encyclopedia of Signaling Molecules. Springer, Cham. * . ...
https://rd.springer.com/referenceworkentry/10.1007%2F978-3-319-67199-4_305
*  Axl - Receptor protein-tyrosine kinase - Mus musculus (Mouse) - Axl gene & protein
PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. ... PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00109. PROTEIN_KINASE_TYR. 1 hit. ... IPR000719. Prot_kinase_dom. IPR017441. Protein_kinase_ATP_BS. IPR001245. Ser-Thr/Tyr_kinase_cat_dom. IPR008266. Tyr_kinase_AS. ... IPR000719. Prot_kinase_dom. IPR017441. Protein_kinase_ATP_BS. IPR001245. Ser-Thr/Tyr_kinase_cat_dom. IPR008266. Tyr_kinase_AS. ...
http://www.uniprot.org/uniprot/Q3TTM4
*  RCSB PDB - Protein Feature View - Protein-tyrosine kinase 2-beta - Q14289 (FAK2 HUMAN)
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex ... ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. UniProt ... Non-receptor protein-tyrosine kinase that regulates reorganization of the actin cytoskeleton, cell polarization, cell migration ... this leads to the phosphorylation of additional tyrosine residues, creating binding sites for scaffold proteins, effectors and ...
http://www.rcsb.org/pdb/protein/Q14289
*  Control of Genetically Prescribed Protein Tyrosine Kinase Activities by Environment-Linked Redox Reactions
A. A. Akhand, M. Kato, H. Suzuki et al., "Carbonyl compounds cross-link cellular proteins and activate protein-tyrosine kinase ... P. Chiarugi and P. Cirri, "Redox regulation of protein tyrosine phosphatases during receptor tyrosine kinase signal ... H. P. Monteiro, R. J. Arai, and L. R. Travassos, "Protein tyrosine phosphorylation and protein tyrosine nitration in redox ... phosphorylation and dephosphorylation of specific tyrosine residues on the kinase protein by other PTKs or protein tyrosine ...
https://www.hindawi.com/journals/er/2011/896567/
*  Control of Genetically Prescribed Protein Tyrosine Kinase Activities by Environment-Linked Redox Reactions
... Izumi Nakashima, ... Izumi Nakashima, Yoshiyuki Kawamoto, Kozue Takeda, and Masashi Kato, "Control of Genetically Prescribed Protein Tyrosine Kinase ...
https://www.hindawi.com/journals/er/2011/896567/cta/
*  Protein-tyrosine kinases | definition of protein-tyrosine kinases by Medical dictionary
What is protein-tyrosine kinases? Meaning of protein-tyrosine kinases medical term. What does protein-tyrosine kinases mean? ... Looking for online definition of protein-tyrosine kinases in the Medical Dictionary? protein-tyrosine kinases explanation free ... protein-tyrosine kinases. Also found in: Dictionary. protein-tyrosine kinases. A large class of enzymes that catalyse the ... medical-dictionary.thefreedictionary.com/protein-tyrosine+kinases',protein-tyrosine kinases,/a,. *Facebook ...
http://medical-dictionary.thefreedictionary.com/protein-tyrosine+kinases
*  Shc proteins are phosphorylated and regulated by the v-Src and v-Fps protein-tyrosine kinases. | PNAS
SH2/SH3 Adaptor Proteins Can Link Tyrosine Kinases to a Ste20-related Protein Kinase, HPK1 ... Shc proteins are phosphorylated and regulated by the v-Src and v-Fps protein-tyrosine kinases.. J McGlade, A Cheng, G Pelicci, ... The Fes Protein-Tyrosine Kinase Phosphorylates a Subset of Macrophage Proteins That Are Involved in Cell Adhesion and Cell-Cell ... Calcium- and Protein Kinase C Dependent Activation of the Tyrosine Kinase PYK2 by Angiotensin II in Vascular Smooth Muscle ...
https://www.pnas.org/content/89/19/8869
*  Protein Tyrosine Kinase Compound Library-MedchemExpress
Protein Tyrosine Kinase Compound Library. Cat. No.: HY-L016 Library Contents: XLSX PDF ... Protein Tyrosine Kinase Compound Library Neuronal Signaling Compound Library PI3K/Akt/mTOR Compound Library .... ... Contents of Protein Tyrosine Kinase Compound Library Plate layout: HY-L016-1 ... GPCR/G Protein Compound Library Anti-Cancer Compound Library Kinase Inhibitor Library Immuno-Oncology Compound Library ...
https://www.medchemexpress.com/screening/Protein_Tyrosine_Kinase_Compound_Library.html
*  Targeting mutated protein tyrosine kinases and their signaling pathways in hematologic malignancies | Haematologica
Targeting mutated protein tyrosine kinases and their signaling pathways in hematologic malignancies ... Targeting mutated protein tyrosine kinases and their signaling pathways in hematologic malignancies ... Targeting mutated protein tyrosine kinases and their signaling pathways in hematologic malignancies ... and this is particularly true with regard to deregulated protein tyrosine kinase (PTK) activation. This progress had led to the ...
http://www.haematologica.org/content/90/7/949
*  Human Metabolome Database: Showing Protein Protein-tyrosine kinase 2-beta (HMDBP01425)
Showing Protein Protein-tyrosine kinase 2-beta (HMDBP01425). IdentificationBiological propertiesGene propertiesProtein ... Protein tyrosine kinase PYK2 involved in Ca(2+)-induced regulation of ion channel and MAP kinase functions. Nature. 1995 Aug 31 ... a novel protein-tyrosine kinase of the focal adhesion kinase subfamily. J Biol Chem. 1995 Sep 8;270(36):21206-19. [PubMed: ... Protein Sequence. ,Protein-tyrosine kinase 2-beta MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK ...
http://www.hmdb.ca/proteins/HMDBP01425
*  Hamster Protein-Tyrosine Kinase Activity to Dog Hair Cell Differentiation from Cell Signaling Technology
Hamster Protein-Tyrosine Kinase Activity, Hamster Negative Regulation of Apoptosis, Hamster Mitosis, Hamster Mitochondrial ... Hamster Protein-Tyrosine Kinase Activity Hamster Protein-Tyrosine Kinase Activity: Polyclonal Antibody - Akt Antibody, UniProt ... Category listing: Hamster Protein-Tyrosine Kinase Activity to Dog Hair Cell Differentiation ... ELISA Kit Unfolded Protein Response ELISA Kit Unfolded Protein Response: PathScan® Total HSP27 Sandwich ELISA Kit - ELISA, ...
https://www.cellsignal.com/1/4/indexd93.html
*  Integrin-dependent phosphorylation and activation of the protein tyrosine kinase pp125FAK in platelets. | JCB
Integrin-dependent phosphorylation and activation of the protein tyrosine kinase pp125FAK in platelets.. L Lipfert, B Haimovich ... Integrin-dependent phosphorylation and activation of the protein tyrosine kinase pp125FAK in platelets. ... in platelets by examining integrin-dependent phosphorylation and activation of a newly identified protein tyrosine kinase, ... This kinase was previously shown to be localized in focal adhesions in fibroblasts, and to be phosphorylated on tyrosine in ...
http://jcb.rupress.org/content/119/4/905?ijkey=42f6feede635fef46990b43381861ee623a73c3e&keytype2=tf_ipsecsha
*  Protein-Tyrosine Kinase Inhibitor (STI571) for Treatment of Patients With Ph+ Chronic Myeloid Leukemia - Tabular View -...
Protein-Tyrosine Kinase Inhibitor (STI571) for Treatment of Patients With Ph+ Chronic Myeloid Leukemia. The safety and ... Protein-Tyrosine Kinase Inhibitor (STI571) for Treatment of Patients With Ph+ Chronic Myeloid Leukemia Who Are Resistant to or ... Protein-Tyrosine Kinase Inhibitor (STI571) for Treatment of Patients With Ph+ Chronic Myeloid Leukemia. ...
https://clinicaltrials.gov/ct2/show/record/NCT00511303