Death-associated protein kinase (DAPK) is a pro-apoptotic serine/threonine kinase involved in apoptosis. Aberrant methylation ... Epigenetic down-regulation of death-associated protein kinase in lung cancers. https://edrn.nci.nih.gov/publications/12912953- ... and its protein was not detected by Western blotting in 17 of 23 (74%) cell lines. We investigated methylation status of 5 ...
Death-associated protein kinase (DAPK) is really a calmodulin-regulated serine/threonine kinase and August 2, 2018. by Felix ... Death-associated protein kinase (DAPK) is really a calmodulin-regulated serine/threonine kinase and possesses apoptotic and ... Death-associated proteins kinase (DAPK) is really a calmodulin-regulated and cytoskeleton-associated serine/threonine kinase ( ... cytoplasmic adaptor proteins, and Rho family members guanosine triphosphatases PKCA (GTPases; Ridley et al., 2003). The Rho ...
A serine/threonine protein kinase (EC 2.7.11.1) is a kinase enzyme that phosphorylates the OH group of serine or threonine ( ... Serine/threonine-specific protein kinase. From Wikipedia, the free encyclopedia. (Redirected from Non-specific serine/threonine ... specifically protein-serine/threonine kinases. These enzymes transfer phosphates to the oxygen atom of a serine or threonine ... Serine/threonine protein kinase p90-kDa ribosomal S6 kinase (RSK) is in involved in development of some prostate cancers.[10] ...
Lambda/iota protein kinase C-interacting protein; Lambda-interacting protein; LIP; Phosphatidylinositol 3-kinase-related kinase ... Phosphatidylinositol 3-kinase-related kinase; Phosphatidylinositol 3-kinase-related protein kinase; PI-3-kinase-related kinase ... 61E3.4; ATX; hSMG-1; KIAA0421; Lambda/iota protein kinase C-interacting protein; Lambda-interacting protein; LIP; ... Yamashita A. (2018) Serine/Threonine-Protein Kinase SMG1. In: Choi S. (eds) Encyclopedia of Signaling Molecules. Springer, Cham ...
We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their ... InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites ... GO:0006468 protein phosphorylation Molecular Function. GO:0005524 ATP binding GO:0004674 protein serine/threonine kinase ... This entry represents serine/threonine-protein kinases (EC:2.7.11.1) such as Rio3. RIO kinases are atypical members of the ...
We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their ... InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites ...
Eukaryotic phytochromes: Light-regulated serine/threonine protein kinases with histidine kinase ancestry. Kuo-Chen Yeh and J. ... Eukaryotic phytochromes: Light-regulated serine/threonine protein kinases with histidine kinase ancestry ... Eukaryotic phytochromes: Light-regulated serine/threonine protein kinases with histidine kinase ancestry ... Eukaryotic phytochromes: Light-regulated serine/threonine protein kinases with histidine kinase ancestry ...
serine/threonine protein kinase. Locus tag. Synpcc7942_0600. Gene type. protein coding. RefSeq status. PROVISIONAL. Organism. ... mRNA and Protein(s) * YP_399619.1 serine/threonine protein kinase [Synechococcus elongatus PCC 7942] ... Synpcc7942_0600 serine/threonine protein kinase [ Synechococcus elongatus PCC 7942 ] Gene ID: 3775318, discontinued on 5-Feb- ... General protein information Go to the top of the page Help Names. serine/threonine protein kinase. ...
Rabbit polyclonal Serine/threonine-protein kinase 4 antibody validated for WB, IHC, ICC/IF and tested in Human. Referenced in 1 ... Anti-Serine/threonine-protein kinase 4 antibody. See all Serine/threonine-protein kinase 4 primary antibodies. ... Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.. Contains 1 protein kinase ... Anti-Serine/threonine-protein kinase 4 antibody (ab97399) at 1/1000 dilution + HepG2 whole cell lysate at 30 µg. Predicted band ...
... receptor type I serine/threonine protein kinase, receptor type II serine/threonine protein kinase, STK13, TGF-beta kinase, and ... In enzymology, a receptor protein serine/threonine kinase (EC 2.7.11.30) is an enzyme that catalyzes the chemical reaction ATP ... to be specific those transferring phosphorus-containing groups protein-serine/threonine kinases. The systematic name of this ... receptor serine/threonine protein kinase. This enzyme participates in 7 metabolic pathways: MAPK signaling pathway, cytokine- ...
A serine/threonine protein kinase (EC 2.7.11.1) is a kinase enzyme that phosphorylates the OH group of serine or threonine ( ... Serine/threonine kinase (STK) expression is altered in many types of cancer. Serine/threonine protein kinase p90-kDa ribosomal ... specifically protein-serine/threonine kinases. These enzymes transfer phosphates to the oxygen atom of a serine or threonine ... At least 125 of the 500+ human protein kinases are serine/threonine kinases (STK). In enzymology, the term non-specific serine/ ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex ... This protein in other organisms (by gene name): Q13188 - Homo sapiens 9 * A8K722 - Homo sapiens no matching PDB entries ... in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, ... Protein disorder predictions are based on JRONN (Troshin, P. and Barton, G. J. unpublished), a Java implementation of RONN * ...
The PDB archive contains information about experimentally-determined structures of proteins, nucleic acids, and complex ... Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, ... ATP + L-threonyl-[protein] = ADP + H+ + O-phospho-L-threonyl-[protein] UniProt ... This protein in other organisms (by gene name): O00141 - Homo sapiens 3 * Q9UN56 - Homo sapiens no matching PDB entries ...
Serine/threonine protein kinase UL97. Details. Name. Serine/threonine protein kinase UL97. Kind. protein. Organism. Not ... Serine/threonine protein kinase UL97. Q68101. Details. Drug Relations. Drug Relations. DrugBank ID. Name. Drug group. ...
... serine/threonine kinase) [Mu... Bmpr2 bone morphogenetic protein receptor, type II (serine/threonine kinase) [Mus musculus]. ... S_TKc; Serine/Threonine protein kinases, catalytic domain. cd14054. Location:207 → 504. STKc_BMPR2_AMHR2; Catalytic domain of ... S_TKc; Serine/Threonine protein kinases, catalytic domain. cd14054. Location:207 → 504. STKc_BMPR2_AMHR2; Catalytic domain of ... bone morphogenetic protein receptor, type II (serine/threonine kinase)provided by MGI. Primary source. MGI:MGI:1095407 See ...
Protein Serine/Threonine Kinase StkP Positively Controls Virulence and Competence in Streptococcus pneumoniae Jose Echenique, ... Identification of Two Eukaryote-Like Serine/Threonine Kinases Encoded by Chlamydia trachomatis Serovar L2 and Characterization ... Phosphoinositide 3 Kinase Mediates Toll-Like Receptor 4-Induced Activation of NF-κB in Endothelial Cells Xianwu Li, Joan C. ... Modulation of Myosin Light-Chain Phosphorylation by p21-Activated Kinase 1 in Escherichia coli Invasion of Human Brain ...
Protein serine/threonine kinase activity. Specific Function. AKT2 is one of 3 closely related serine/threonine-protein kinases ... lcl,BSEQ0002331,RAC-beta serine/threonine-protein kinase MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC ... a putative oncogene encoding a member of a subfamily of protein-serine/threonine kinases, is amplified in human ovarian ... Activation of protein kinase B beta and gamma isoforms by insulin in vivo and by 3-phosphoinositide-dependent protein kinase-1 ...
Acts upstream of phosphatidylinositol 3-kinase PIK3C3 to regulate the formation of autophagophores, the precursors of ... Serine/threonine-protein kinase involved in autophagy in response to starvation. ... View protein in PROSITE. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 ... View protein in PROSITE. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 ...
Phosphorylates ATF5 but also stabilizes ATF5 protein levels in a kinase-independent manner. ... Serine/threonine-protein kinase that regulates a number of transcription factors with key roles in cell fate determination. ... PS00107 PROTEIN_KINASE_ATP, 1 hit. PS50011 PROTEIN_KINASE_DOM, 1 hit. PS00108 PROTEIN_KINASE_ST, 1 hit. ... PS00107 PROTEIN_KINASE_ATP, 1 hit. PS50011 PROTEIN_KINASE_DOM, 1 hit. PS00108 PROTEIN_KINASE_ST, 1 hit. ...
There are no specific protocols for Anti-Serine/threonine-protein kinase 4 antibody [EP1465Y] (ab51134). Please download our ... Proteins and Peptides. Proteomics tools. Agonists, activators, antagonists and inhibitors. Lysates. Multiplex miRNA assays. By ...
AKT2, a putative oncogene encoding a member of a subfamily of protein-serine/threonine kinases, is amplified in human ovarian ... AKT2, a putative oncogene encoding a member of a subfamily of protein-serine/threonine kinases, is amplified in human ovarian ... AKT2, a putative oncogene encoding a member of a subfamily of protein-serine/threonine kinases, is amplified in human ovarian ... AKT2, a putative oncogene encoding a member of a subfamily of protein-serine/threonine kinases, is amplified in human ovarian ...
... protein serine/threonine kinase activity; INVOLVED IN protein phosphorylation; INTERACTS WITH 17beta-estradiol; benzo[a]pyrene ... ENCODES a protein that exhibits ATP binding; magnesium ion binding; ... protein serine/threonine kinase activity IDA. 2290271. UniProtKB. PMID:15733851. protein serine/threonine kinase activity IBA. ... Nim1k (NIM1 serine/threonine protein kinase). NCBI. Ortholog. Sus scrofa (pig):. NIM1K (NIM1 serine/threonine protein kinase). ...
... mammalian STE20-like protein kinase 4 , serine/threonine protein kinase MST4 , serine/threonine-protein kinase MST4 , mammalian ... anti-Serine/threonine-Protein Kinase PRP4 Homolog Antibodies * anti-Serine/threonine-Protein Phosphatase 4 Regulatory Subunit ... anti-Serine/threonine Protein Phosphatase Ppa2 Antibodies * anti-Serine/threonine Kinase Receptor Associated Protein Antibodies ... Serine/threonine-Protein Kinase MST4 (MST4) Antigen Profile Protein Summary The product of this gene is a member of the GCK ...
serine/threonine-protein kinase DCLK1-like Symbol and Name status set to provisional. 70820. PROVISIONAL. ... total urine protein amount (VT:0000032). urine protein excretion rate (CMO:0000759). 2. 115721880. 154182196. Rat. ... GenBank Protein. EDM14902. (Get FASTA). NCBI Sequence Viewer Reference Sequences. RefSeq Acc Id:. XP_008773371 ⟸ XM_ ... Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer ( ...
... cell shape and cell division via phosphorylation of target proteins such as FtsZ, Wag31, GlmU, FhaB, PstP, EmbR and Rv1422 ( ... Protein kinase that regulates many aspects of mycobacterial physiology, and is critical for growth in vitro and survival of the ... Transmembrane serine/threonine-protein kinase a PknA (Protein kinase a) (STPK A). MYCTX ... Transmembrane serine/threonine-protein kinase a PknA (Protein kinase a) (STPK A). MYCTX ...