Protein phosphatase 1 - Wikipedia
This type of phosphatase includes metal-dependent protein phosphatases (PPMs) and aspartate-based phosphatases. PP1 has been ... The herpes simplex virus protein ICP34.5 also activates protein phosphatase 1, which overcomes the cellular stress response to ... belongs to a certain class of phosphatases known as protein serine/threonine phosphatases. ... Protein+Phosphatase+1 at the U.S. National Library of Medicine Medical Subject Headings (MeSH) Portal: Biology (CS1: long ...
PPP1R10 protein phosphatase 1 regulatory subunit 10 [Homo sapiens (human)] - Gene - NCBI
Protein interactions. Protein. Gene. Interaction. Pubs. Tat tat Depletion of protein phosphatase 1, regulatory subunit 10 ( ... General protein information Go to the top of the page Help Preferred Names. serine/threonine-protein phosphatase 1 regulatory ... mRNA and Protein(s) * XM_011514722.2 → XP_011513024.1 serine/threonine-protein phosphatase 1 regulatory subunit 10 isoform X1 ... mRNA and Protein(s) * XM_054329833.1 → XP_054185808.1 serine/threonine-protein phosphatase 1 regulatory subunit 10 isoform X1 ...
Orphanet: protein phosphatase 1 catalytic subunit beta
Ppp1r15a MGI Mouse Gene Detail - MGI:1927072 - protein phosphatase 1, regulatory subunit 15A
protein coding gene. Chr7:45172340-45175692 (-). 129S1/SvImJ MGP_129S1SvImJ_G0032228. protein coding gene. Chr7:45799628- ... protein coding gene. Chr7:47457919-47461560 (-). CAST/EiJ MGP_CASTEiJ_G0031263. protein coding gene. Chr7:38068015-38071255 (-) ... protein coding gene. Chr7:46646887-46650011 (-). C57BL/6NJ MGP_C57BL6NJ_G0032711. protein coding gene. Chr7:48067838-48070962 ... protein coding gene. Chr7:46498131-46501255 (-). NOD/ShiLtJ MGP_NODShiLtJ_G0032045. protein coding gene. Chr7:48353883-48357007 ...
Ppp1r1a MGI Mouse Gene Detail - MGI:1889595 - protein phosphatase 1, regulatory inhibitor subunit 1A
protein coding gene. Chr15:103438706-103446465 (-). 129S1/SvImJ MGP_129S1SvImJ_G0022445. protein coding gene. Chr15:105800578- ... protein coding gene. Chr15:101609620-101617256 (-). AKR/J MGP_AKRJ_G0022382. protein coding gene. Chr15:104696157-104703887 (-) ... protein coding gene. Chr15:105658342-105665874 (-). CBA/J MGP_CBAJ_G0022147. protein coding gene. Chr15:113548998-113558129 (-) ... protein coding gene. Chr15:100888375-100895890 (-). FVB/NJ MGP_FVBNJ_G0022254. protein coding gene. Chr15:99941100-99948615 (-) ...
Receptor-Like Protein Tyrosine Phosphatases, Class 3 - Medical Dictionary online-medical-dictionary.org
Learn about Receptor-Like Protein Tyrosine Phosphatases, Class 3 at online-medical-dictionary.org ... PTPRH Phosphatase. PTPRJ Phosphatase. PTPRO Phosphatase. PTPRQ Phosphatase. PTPRV Phosphatase. Phosphatase eta, Protein- ... Protein Tyrosine Phosphatase eta. Protein Tyrosine Phosphatase, Receptor Type B. Protein Tyrosine Phosphatase, Receptor Type H ... Protein Tyrosine Phosphatase, Receptor Type Q. Protein Tyrosine Phosphatase, Receptor Type V. Protein-Tyrosine Phosphatase eta ...
Protein phosphatase 1 regulates assembly and function of the beta-catenin degradation complex.
"Protein phosphatase 1 regulates assembly and function of the beta-catenin degradation complex." EMBO J, vol. 26, no. 6, Mar. ... Protein phosphatase 1 regulates assembly and function of the beta-catenin degradation complex.. Publication , Journal Article ... "Protein phosphatase 1 regulates assembly and function of the beta-catenin degradation complex." EMBO J 26, no. 6 (March 21, ... Protein phosphatase 1 regulates assembly and function of the beta-catenin degradation complex. EMBO J. 2007 Mar 21;26(6):1511- ...
RCSB PDB - 1C88: CRYSTAL STRUCTURE OF PROTEIN TYROSINE PHOSPHATASE 1B COMPLEXED WITH 2-(OXALYL-AMINO)-4,5,6,7-TETRAHYDRO-THIENO...
CRYSTAL STRUCTURE OF PROTEIN TYROSINE PHOSPHATASE 1B COMPLEXED WITH 2-(OXALYL-AMINO)-4,5,6,7-TETRAHYDRO-THIENO[2,3-C]PYRIDINE-3 ... CRYSTAL STRUCTURE OF PROTEIN TYROSINE PHOSPHATASE 1B COMPLEXED WITH 2-(OXALYL-AMINO)-4,5,6,7-TETRAHYDRO-THIENO[2,3-C]PYRIDINE-3 ... Several protein-tyrosine phosphatases (PTPs) have been proposed to act as negative regulators of insulin signaling. Recent ... and highly selective inhibitor of protein-tyrosine phosphatase 1B.. Iversen, L.F., Andersen, H.S., Branner, S., Mortensen, S.B. ...
Transforming growth factor {beta} (TGF-{beta})-Smad target gene protein tyrosine phosphatase receptor type kappa is required...
... we identified novel Smad targets including protein tyrosine phosphatase receptor type kappa (PT … ... receptor type protein tyrosine phosphatase kappa, the protein product encoded by the PTPRK gene) protein in tumor and nontumor ... Transforming growth factor {beta} (TGF-{beta})-Smad target gene protein tyrosine phosphatase receptor type kappa is required ... we identified novel Smad targets including protein tyrosine phosphatase receptor type kappa (PTPRK). TGF-beta up-regulated ...
phosphatase 1 - Protein Phosphatases
Protein phosphatase, Recombinant Protein * Protein Phosphatase Serine, Threonine, Monoclonal Antibody * Protein Phosphatase ... Protein phosphatase, Recombinant Protein * Protein Phosphatase Serine, Threonine, Monoclonal Antibody * Protein Phosphatase ... Protein phosphatase, Recombinant Protein * Protein Phosphatase Serine, Threonine, Monoclonal Antibody * Protein Phosphatase ...
Particles - Protein phosphatase 1 (PP1)
Phosphoproteome and drug response effects mediated by the three Protein Phosphatase 2A inhibitor proteins CIP2A, SET and PME-1. ... Phosphoproteome and drug response effects mediated by the three Protein Phosphatase 2A inhibitor proteins CIP2A, SET and PME-1. ... Phosphoproteome and drug response effects mediated by the three Protein Phosphatase 2A inhibitor proteins CIP2A, SET and PME-1. ... Dopamine and cAMP-regulated phosphoprotein 32kDa (DARPP-32), protein phosphatase-1 and cyclin-dependent kinase 5 expression in ...
Cell transformation by FLT3 ITD in acute myeloid leukemia involves oxidative inactivation of the tumor suppressor protein...
This study addressed the role of DEP-1 for regulation of the acute myeloid leukemia (AML)-related mut … ... is regulated by protein-tyrosine phosphatases (PTPs). We recently identified the PTP DEP-1/CD148/PTPRJ as a novel negative ... Receptor-Like Protein Tyrosine Phosphatases, Class 3 / genetics * Receptor-Like Protein Tyrosine Phosphatases, Class 3 / ... Signal transduction of FMS-like tyrosine kinase 3 (FLT3) is regulated by protein-tyrosine phosphatases (PTPs). We recently ...
dna genetics - Protein phosphatase 1 (PP1)
Phosphoproteome and drug response effects mediated by the three Protein Phosphatase 2A inhibitor proteins CIP2A, SET and PME-1. ... Phosphoproteome and drug response effects mediated by the three Protein Phosphatase 2A inhibitor proteins CIP2A, SET and PME-1. ... Dopamine and cAMP-regulated phosphoprotein 32kDa (DARPP-32), protein phosphatase-1 and cyclin-dependent kinase 5 expression in ... Dopamine and cAMP-regulated phosphoprotein 32kDa (DARPP-32), protein phosphatase-1 and cyclin-dependent kinase 5 expression in ...
Drugging the undruggable: new approaches to exploiting the protein tyrosine phosphatase PTP1B as a therapeutic target |...
T3DB: Protein phosphatase 1 regulatory subunit 1B
lcl,BSEQ0009126,Protein phosphatase 1 regulatory subunit 1B MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGE ... lcl,BSEQ0013628,Protein phosphatase 1 regulatory subunit 1B (PPP1R1B) ... 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039 *Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL ... 1994 Mar;14(3 Pt 1):985-98. 8120638 *El-Rifai W, Smith MF Jr, Li G, Beckler A, Carl VS, Montgomery E, Knuutila S, Moskaluk CA, ...
Domains Necessary for Gα12 Binding and Stimulation of Protein Phosphatase-2A (PP2A): Is Gα12 a Novel Regulatory Subunit of PP2A...
Domains Necessary for Gα12 Binding and Stimulation of Protein Phosphatase-2A (PP2A): Is Gα12 a Novel Regulatory Subunit of PP2A ... Domains Necessary for Gα12 Binding and Stimulation of Protein Phosphatase-2A (PP2A): Is Gα12 a Novel Regulatory Subunit of PP2A ... Domains Necessary for Gα12 Binding and Stimulation of Protein Phosphatase-2A (PP2A): Is Gα12 a Novel Regulatory Subunit of PP2A ... Domains Necessary for Gα12 Binding and Stimulation of Protein Phosphatase-2A (PP2A): Is Gα12 a Novel Regulatory Subunit of PP2A ...
SCOPe 2.07: Protein: Autoinducer 2 sensor kinase/phosphatase LuxQ
Timeline for Protein Autoinducer 2 sensor kinase/phosphatase LuxQ from d.110.6.3: LuxQ-periplasmic domain-like: *Protein ... Lineage for Protein: Autoinducer 2 sensor kinase/phosphatase LuxQ. *Root: SCOPe 2.07 *. Class d: Alpha and beta proteins (a+b) ... Protein Autoinducer 2 sensor kinase/phosphatase LuxQ from d.110.6.3: LuxQ-periplasmic domain-like appears in SCOPe 2.06. * ... Protein Autoinducer 2 sensor kinase/phosphatase LuxQ from d.110.6.3: LuxQ-periplasmic domain-like appears in the current ...
Salicylic acid targets protein phosphatase 2A to attenuate growth in plants
... Shutang Tan, Melinda Abas, Inge Verstraeten (UGent ... "Salicylic Acid Targets Protein Phosphatase 2A to Attenuate Growth in Plants." CURRENT BIOLOGY 30: 381-395. doi:10.1016/j.cub. ... S. Tan et al., "Salicylic acid targets protein phosphatase 2A to attenuate growth in plants," CURRENT BIOLOGY, vol. 30, pp. 381 ... "Salicylic Acid Targets Protein Phosphatase 2A to Attenuate Growth in Plants." CURRENT BIOLOGY, vol. 30, 2020, pp. 381-95, doi: ...
1244-P: The Protein Phosphatase PPm1k Regulates Ribosomal Protein S6 Phosphorylation in Beta Cells | Diabetes | American...
Phosphorylation of ribosomal protein S6 (RPS6) on ser235/236 and ser240/244 in the pancreatic beta cell increases cell size and ... 1244-P: The Protein Phosphatase PPm1k Regulates Ribosomal Protein S6 Phosphorylation in Beta Cells YANN DELEYE; YANN DELEYE ... The Protein Phosphatase PPm1k Regulates Ribosomal Protein S6 Phosphorylation in Beta Cells. Diabetes 1 June 2021; 70 ( ... Our phosphoproteomic analysis identified the protein phosphatase, PPm1K, as a novel regulator of RPS6 phosphorylation. We find ...
Crystal structure of the catalytic domain of protein-tyrosine phosphatase SHP-1
Protein Structure, Secondary. Protein Structure, Tertiary. Protein Tyrosine Phosphatase, Non-Receptor Type 11. Protein Tyrosine ... Protein Tyrosine Phosphatases. Recombinant Proteins. Sequence Homology, Amino Acid. Surface Properties. Tungsten Compounds. ... The crystal structures of the protein-tyrosine phosphatase SHP-1 catalytic domain and the complex it forms with the substrate ... These protein kinases correspond to alternatively spliced isoforms derived from the JNK1, JNK2 and JNK3 genes. The protein ...
Mouse PPP1R15A(Protein Phosphatase 1, Regulatory Subunit 15A) ELISA Kit - Hiv Pharmacogenomics
Rat Protein Phosphatase 1, Regulatory Subunit 15A (PPP1R15A) ELISA Kit. SEC199Ra-1x48wellstestplate Cloud-Clone 1x48-wells test ... Rat Protein Phosphatase 1, Regulatory Subunit 15A (PPP1R15A) ELISA Kit. SEC199Ra-1x96wellstestplate Cloud-Clone 1x96-wells test ... Rat Protein Phosphatase 1, Regulatory Subunit 15A (PPP1R15A) ELISA Kit. SEC199Ra-5x96wellstestplate Cloud-Clone 5x96-wells test ... Rat Protein Phosphatase 1, Regulatory Subunit 15A (PPP1R15A) ELISA Kit. SEC199Ra-10x96wellstestplate Cloud-Clone 10x96-wells ...
Recombinant Protein phosphatase 1 regulatory subunit 12B (PPP1R12B) partial | Technique alternative | 03025099026 - PP1B
protein phosphatase methylesterase 1 | 3.1.1.- Carboxylic Ester Hydrolases | IUPHAR Guide to IMMUNOPHARMACOLOGY
Regulation of protein phosphatase inhibitor-1 by cyclin-dependent kinase 5<...
Regulation of protein phosphatase inhibitor-1 by cyclin-dependent kinase 5. Chan Nguyen, Akinori Nishi, Janice W. Kansy, Joseph ... Regulation of protein phosphatase inhibitor-1 by cyclin-dependent kinase 5. Journal of Biological Chemistry. 2007 Jun 1;282(22 ... Regulation of protein phosphatase inhibitor-1 by cyclin-dependent kinase 5. In: Journal of Biological Chemistry. 2007 ; Vol. ... Regulation of protein phosphatase inhibitor-1 by cyclin-dependent kinase 5. / Nguyen, Chan; Nishi, Akinori; Kansy, Janice W. et ...
Determination of the molecular reach of the protein tyrosine phosphatase SHP-1 - Oxford Neuroscience
We find that the reach of PD-1—SHP-1 complexes is dominated by the 13.0 nm reach of SHP-1 itself. This is longer than an ... In this work, we determine the molecular reach for the enzyme SHP-1 and the receptor PD-1 to which it can tether, and show how ... Using modelling, we show that when uniformly distributed, PD-1—SHP-1 complexes can only reach 15% of substrates but this ... When within reach, we show that membrane recruitment increases the activity of SHP-1 by a 1000-fold increase in local ...
Regulation of neurabin I interaction with protein phosphatase 1 by phosphorylation. | Department of Anesthesiology
Nerve Tissue Proteins, Peptide Fragments, Phosphoprotein Phosphatases, Phosphorylation, Precipitin Tests, Protein Phosphatase 1 ... Neurabin I is a brain-specific actin-binding protein. Here we show that neurabin I binds protein phosphatase 1 (PP1) and ... Amino Acid Sequence, Animals, Brain, Cyclic AMP-Dependent Protein Kinases, Male, Microfilament Proteins, Molecular Sequence ... A glutathione S-transferase (GST)-neurabin I fusion protein (residues 318-661) containing the putative PP1 binding domain ( ...
Vanadium in PDB 6phs: Protein Tyrosine Phosphatase 1B (1-301), P185A Mutant, Vanadate Bound State
Protein Tyrosine Phosphatase 1B (1-301), P185A Mutant, Vanadate Bound State ... Protein crystallography data. The structure of Protein Tyrosine Phosphatase 1B (1-301), P185A Mutant, Vanadate Bound State, PDB ... Enzymatic activity of Protein Tyrosine Phosphatase 1B (1-301), P185A Mutant, Vanadate Bound State. All present enzymatic ... The binding sites of Vanadium atom in the Protein Tyrosine Phosphatase 1B (1-301), P185A Mutant, Vanadate Bound State (pdb code ...
Frontiers | Phosphatase PTPN22 Regulates Dendritic Cell Homeostasis and cDC2 Dependent T Cell Responses
Using Ptpn22−/− mice we demonstrate that the phosphatase PTPN22 is a highly selective, negative regulator of cDC2 homeostasis, ... Using Ptpn22-/- mice we demonstrate that the phosphatase PTPN22 is a highly selective, negative regulator of cDC2 homeostasis, ... He R-J, Yu Z-H, Zhang R-Y, Zhang Z-Y. Protein tyrosine phosphatases as potential therapeutic targets. Acta Pharmacol Sin. (2014 ... Protein tyrosine phosphatase PTPN22 regulates LFA-1 dependent Th1 responses. J Autoimmun. (2018) 94:45-55. doi: 10.1016/j.jaut. ...
Protein phosphatase 1 modulation of neostriatal AMPA channels: Regulation by DARPP-32 and spinophilin<...
Protein phosphatase 1 modulation of neostriatal AMPA channels: Regulation by DARPP-32 and spinophilin. Nature Neuroscience. ... Protein phosphatase 1 modulation of neostriatal AMPA channels : Regulation by DARPP-32 and spinophilin. In: Nature Neuroscience ... Protein phosphatase 1 modulation of neostriatal AMPA channels: Regulation by DARPP-32 and spinophilin. / Yan, Zhen; Hsieh- ... Yan, Z, Hsieh-Wilson, L, Feng, J, Tomizawa, K, Allen, PB, Fienberg, AA, Nairn, AC & Greengard, P 1999, Protein phosphatase 1 ...
Expression, purification and preliminary crystal analysis of the human low Mr phosphotyrosine protein phosphatase isoform 1.
The genes of the human low Mr phosphotyrosine protein phosphatase (PTPase) isoforms 1 (IF1) and 2 (IF2) were isolated by ... Expression, purification and preliminary crystal analysis of the human low Mr phosphotyrosine protein phosphatase isoform 1.. ... The genes of the human low Mr phosphotyrosine protein phosphatase (PTPase) isoforms 1 (IF1) and 2 (IF2) were isolated by ... Expression, purification and preliminary crystal analysis of the human low Mr phosphotyrosine protein phosphatase isoform 1 / R ...