Loading...
*  Persistent Gene Expression in the Ovine Lung from a Human Elongation Factor 1 Alpha Promoter Plasmid Following Non-Viral Gene...
Persistent Gene Expression in the Ovine Lung from a Human Elongation Factor 1 Alpha Promoter Plasmid Following Non-Viral Gene Delivery ...
http://www.cfgenetherapy.org.uk/publications/abstract/18
*  Elevated muscle protein synthesis after inactivation of | Open-i
Elevated muscle protein synthesis after inactivation of MuRF1 and MuRF2. (A) The translation elongation factor EEF1G (interacting with MuRF1 and MuRF2; see Figu
https://openi.nlm.nih.gov/detailedresult.php?img=PMC2168395_7601952f6&req=4
*  The effects of enhanced expression of elongation factor EF-1α on lifespan inDrosophila melanogaster | SpringerLink
This paper summarizes three experiments on the genetic manipulation of fitness components involved in the evolution of lifespan through the introduction of an additional copy of the gene for elongation factor EF-1α into the genome ofDrosophila melanogaster. The first experiment checked a prior claim that enhanced expression of elongation factor increased the lifespan of virgin male fruitfies. It used inbred stocks; three treatment and three control lines were available. The second experiment put one treatment and one control insert into different positions on the third chromosome, then measured the influence of six genetic backgrounds on treatment effects in healthier flies. The third experiment put six treatment and six control inserts into the genetic background whose lifespan was most sensitive to the effects of treatment in the second experiment, then measured the influence of insert positions on treatment effects in healthy flies. The ...
https://link.springer.com/article/10.1007%2FBF01435996
*  OriGene - EEF2 (NM 001961) cDNA Clone
EEF2 - EEF2 (untagged)-Human eukaryotic translation elongation factor 2 (EEF2) available for purchase from OriGene - Your Gene Company.
http://www.origene.com/cdna/trueclone/accession/NM_001961/SC118904.aspx
*  The eEF1γ Subunit Contacts RNA Polymerase II and Binds Vimentin Promoter Region - Open Access Library
Here, we show that the eukaryotic translation elongation factor 1 gamma (eEF1γ) physically interacts with the RNA polymerase II (pol II) core subunit 3 (RPB3), both in isolation and in the context of the holo-enzyme. Importantly, eEF1γ has been recently sh...
http://www.oalib.com/paper/137023
*  EEF1A1P10 Gene - GeneCards | EEF1A1P10 Pseudogene
Complete information for EEF1A1P10 gene (Pseudogene), Eukaryotic Translation Elongation Factor 1 Alpha 1 Pseudogene 10, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
http://www.genecards.org/cgi-bin/carddisp.pl?gene=EEF1A1P10
*  EEF1A1P32 Gene - GeneCards | EEF1A1P32 Pseudogene
Complete information for EEF1A1P32 gene (Pseudogene), Eukaryotic Translation Elongation Factor 1 Alpha 1 Pseudogene 32, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
http://www.genecards.org/cgi-bin/carddisp.pl?gene=EEF1A1P32
*  EEF1A1P36 Gene - GeneCards | EEF1A1P36 Pseudogene
Complete information for EEF1A1P36 gene (Pseudogene), Eukaryotic Translation Elongation Factor 1 Alpha 1 Pseudogene 36, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
http://www.genecards.org/cgi-bin/carddisp.pl?gene=EEF1A1P36
*  EEF1A1P9 Gene - GeneCards | EEF1A1P9 Pseudogene
Complete information for EEF1A1P9 gene (Pseudogene), Eukaryotic Translation Elongation Factor 1 Alpha 1 Pseudogene 9, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
http://www.genecards.org/cgi-bin/carddisp.pl?gene=EEF1A1P9
*  EEF1GP3 Gene - GeneCards | EEF1GP3 Pseudogene
Complete information for EEF1GP3 gene (Pseudogene), Eukaryotic Translation Elongation Factor 1 Gamma Pseudogene 3, including: function, proteins, disorders, pathways, orthologs, and expression. GeneCards - The Human Gene Compendium
http://www.genecards.org/cgi-bin/carddisp.pl?gene=EEF1GP3
*  Mycotaxon: Volume 98 Article Abstract
Rehner, Stephen A. , Marilena Aquino de Muro & Joseph W. Bischoff. Description and phylogenetic placement of Beauveria malawiensis sp. nov. (Clavicipitaceae, Hypocreales). Mycotaxon 98: 137 - 145. 2006.. ABSTRACT: A new entomopathogenic species, Beauveria malawiensis, is described. Beauveria malawiensis was isolated from a cadaver of Phoracantha semipunctata (Coleoptera: Cerambycidae) collected in Zomba, Malawi. Morphologically, B. malawiensis is distinguished by its pink colony color, the terminal and intercalary clusters of inflated conidiophores that each gives rise to multiple rachiform conidiogenous cells, and holoblastic cylindrical conidia. Phylogenetic analysis of nuclear ribosomal internal transcribed spacer and translation elongation factor-1 alpha sequences place B. malawiensis apart from other species in the genus that also produce cylindrical conidia, supporting its proposed species status. KEYWORDS: Cordyceps, fungal entomopathogen, new species, taxonomy. ...
http://www.mycotaxon.com/vol/abstracts/98/98-137.html
*  Purification of components of the translation elongation factor complex of Plasmodium falciparum by tandem affinity...
TY - JOUR. T1 - Purification of components of the translation elongation factor complex of Plasmodium falciparum by tandem affinity purification. AU - Takebe,Sachiko. AU - Witola,William Harold. AU - Schimanski,Bernd. AU - Günzl,Arthur. AU - Ben Mamoun,Choukri. PY - 2007/4. Y1 - 2007/4. N2 - Plasmodium falciparum is the causative agent of severe human malaria, responsible for over 2 million deaths annually. Of the 5,300 polypeptides predicted to control the parasite life cycle in mosquitoes and humans, 60% are of unknown function. A major challenge of malaria postgenomic biology is to understand how the 5,300 predicted proteins coexist and interact to perform the essential tasks that define the complex life cycle of the parasite. One approach to assign function to these proteins is by identifying their physiological partners. Here we describe the use of tandem affinity purification (TAP) and mass spectrometry for identification of native protein interactions ...
https://experts.illinois.edu/en/publications/purification-of-components-of-the-translation-elongation-factor-c
*  Ts translation elongation factor, mitochondrial ELISA Kits | Biocompare.com
Compare Ts translation elongation factor, mitochondrial ELISA Kits from leading suppliers on Biocompare. View specifications, prices, citations, reviews, and more.
http://www.biocompare.com/pfu/110627/soids/2-330081/Assay_Kit/ELISA_Ts_translation_elongation_factor_mitochondrial
*  EEF2 - Wikipedia
Eukaryotic elongation factor 2 is a protein that in humans is encoded by the EEF2 gene. This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the ribosome. This protein is completely inactivated by EF-2 kinase phosphorylation. It is the target of diphtheria toxin (from Corynebacterium diphtheriae), and exotoxin A (from Pseudomonas aeruginosa). The inactivation of EF-2 by toxins inhibits protein production in the host, causing symptoms due to loss of function in affected cells. GRCh38: Ensembl release 89: ENSG00000167658 - Ensembl, May 2017 GRCm38: Ensembl release 89: ENSMUSG00000034994 - Ensembl, May 2017 "Human PubMed Reference:". "Mouse PubMed Reference:". Rapp G, Klaudiny J, Hagendorff G, Luck MR, Scheit KH (Mar 1990). "Complete sequence of the coding region of human ...
https://en.wikipedia.org/wiki/EEF2
*  "Eukaryotic elongation factor 2 controls TNF-alpha translation in LPS-i" by Barbara Gonzalez-Teran, Jose R. Cortes et al.
Bacterial LPS (endotoxin) has been implicated in the pathogenesis of acute liver disease through its induction of the proinflammatory cytokine TNF-alpha. TNF-alpha is a key determinant of the outcome in a well-established mouse model of acute liver failure during septic shock. One possible mechanism for regulating TNF-alpha expression is through the control of protein elongation during translation, which would allow rapid cell adaptation to physiological changes. However, the regulation of translational elongation is poorly understood. We found that expression of p38gamma/delta MAPK proteins is required for the elongation of nascent TNF-alpha protein in macrophages. The MKK3/6-p38gamma/delta pathway mediated an inhibitory phosphorylation of eukaryotic elongation factor 2 (eEF2) kinase, which in turn promoted eEF2 activation (dephosphorylation) and subsequent TNF-alpha elongation. These results identify a new ...
http://escholarship.umassmed.edu/davis/3/
*  OriGene - ELOF1 (NM 032377) cDNA Clone
ELOF1 - ELOF1 (untagged)-Human elongation factor 1 homolog (S. cerevisiae) (ELOF1) available for purchase from OriGene - Your Gene Company.
http://www.origene.com/cdna/trueclone/accession/NM_032377/SC104692.aspx
*  Resolving the α-glycosidic linkage of arginine-rhamnosylated translation elongation factor P triggers generation of the first...
Based on previous work,23,24 we chose a strategy for glycopeptide synthesis that involves direct silver-promoted glycosylation between an S-alkyl-isothiourea and the amine of the amino acid side chain on the solid phase. First, we synthesized the key building block, N-glycosyl-S-alkyl-isothiourea 6, starting from L-rhamnose 2 (Fig. 3b): glycosyl chloride 3 in the desired configuration was obtained using well established procedures (85% yield).25,26 Subsequently, 3 was treated with potassium thiocyanate (KSCN) and tetrabutylammonium hydrogen iodide (TBAI) in anhydrous acetonitrile to get glycosyl isothiocyanate 4 (70% yield).27 Next, glycosyl thiourea 5 was prepared via ammoniation of 4 in tetrahydrofuran (99% yield).28 Finally, a two-step, one-pot procedure converted 5 into 6 in the presence of ethyl iodide and tert-butoxycarbonyl anhydride (75% yield).29 Taken together from 2 to 6 we ended up with an efficiency of about 44%. The configuration of the attached rhamnose in the hapten depends ...
http://pubs.rsc.org/en/content/articlehtml/2016/sc/c6sc02889f
*  The elongation factor 1 A-2 isoform from rabbit: cloning of the cDNA and characterization of the protein.
Abstract Eukaryotic elongation factor 1 A (eEF1A, formerly elongation factor-1 alpha) is an important component of the protein synthesis apparatus. Here we report the isolation and..
https://www.omicsonline.org/references/the-elongation-factor-1-a2-isoform-from-rabbit-cloning-of-the-cdna-and-characterization-of-the-protein-438137.html
*  Analysis of Translation Elongation Dynamics in the Context of an Escherichia coli Cell
Understanding the mechanisms behind translation and its rate-limiting steps is crucial for both the development of drug targets and improvement of heterologous protein production with many biotechnological applications, such as in pharmaceutical and biofuel industries. Despite many advances in the knowledge of the ribosome structure and function, there is still much discussion around the determinants of translation elongation with experiments and computational studies pointing in different directions. Here, we use a stochastic framework to simulate the process of translation in the context of an Escherichia coli cell by gathering the available biochemical data into a ribosome kinetics description. Our results from the study of translation in E. coli at different growth rates contradict the increase of mean elongation rate with growth rate established in the literature. We show that both the level of tRNA competition and the type of cognate binding interaction contribute to ...
https://infoscience.epfl.ch/record/223938
*  Sequence Similarity Search - BLAST
apg:APA12_09310 K02358 elongation factor Tu , (GenBank) translation elongation factor Tu (EF-TU) (A) MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKTLAKKGGAEFKAYDQIDAAPEERARG ITISTAHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI LLARQVGVPALVVFLNKVDQVDDPELLELVEMEVRELLSSYQFPGDDVPIIKGSALVTLE DGDPEIGENRVRDLMDAVDSYIPQPERPVDRPFLMPIEDVFSISGRGTVVTGRVERGVIN VGDEIEIVGLKPTTKTTVTGVEMFRKLLDRGEAGDNIGALLRGTKREDVERGQVLAKPGS ITPHKKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNCA MEVELIAPIAMDEGLRFAIREGGRTVGAGVVSSIIE ...
http://www.genome.jp/tools-bin/search_sequence?prog=blast&seqid=apg:APA12_09310+aa
*  Sequence Similarity Search - BLAST
bla:BLA_1148 K02358 elongation factor Tu , (GenBank) tuf; translation elongation factor Tu (A) MAKEKYERTKPHVNIGTIGHVDHGKTTLTAAISKVLHDEYPDLNPEYDFNQIDAAPEEQQ RGITINIAHIEYQTAKRHYAHVDCPGHADFVKNMITGAAQMDGAILVVAATDGPMAQTRE HVLLAPQVGVPKILVALNKCDMVDDEELIELVEEEVRDLLDENGFDRDCPVVHTSAYGAL HDDAPDHDKWVATIKELMDDVDEYIPTPVHDLDKPFLMPIEDVFTISGRGTVVTGRVERG KLPINTNVEIVGIRPTQTTTFTSIETFHKQMDECEAGDNTGLLLRGINRTDVERGQVVAA PGSVTPHTKFEGEVYVLTKDEGGRHSPFFSNYRPQFYFRTTDVTGVITLPEGVEMVQPGD HATFTVELIQPIAMEEGLTFAVREGGHTVGSGRVTKILA ...
http://www.genome.jp/tools-bin/search_sequence?prog=blast&seqid=bla:BLA_1148+aa
*  Sequence Similarity Search - BLAST
cpsn:B712_0748 K02358 elongation factor Tu , (GenBank) tuf; translation elongation factor Tu (A) MSKETFQRTKPHINIGTIGHVDHGKTTLTAAITRALSAEGLANFCDYSSIDNTPEEKARG ITINASHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSATDGAMPQTKEHI LLARQVGVPYIVVFLNKIDMISQEDAELVDLVEMELSELLEEKGYKGCPIIRGSALKALE GDASYVEKIRELMQAVDDNIPTPEREVDKPFLMPIEDVFSISGRGTVVTGRIERGVVKVG DKVQIVGLRDTRETIVTGVEMFRKELPEGQAGENVGLLLRGIGKNDVERGMVICQPNSVK SHTQFKGTVYILQKEEGGRHKPFFTGYRPQFFFRTTDVTGVVTLPEGVEMVMPGDNVEFD VQLISPVALEEGMRFAIREGGRTIGAGTISKIIA ...
http://www.genome.jp/tools-bin/search_sequence?prog=blast&seqid=cpsn:B712_0748+aa
*  EEF2 antibody | acris-antibodies.com
Eukaryotic elongation factor 2 (eEF2) catalyzes the translocation of peptidyl-tR from the A site to the P site on the ribosome. It has been shown that…
https://www.acris-antibodies.com/target/eef2-antibody.htm
*  Switch to Europe/Worldwide website
EEF1G is a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This…
https://www.acris-antibodies.com/target/eef1g-antibody.htm?ab_ag_presentation=Purified
*  Switch to Europe/Worldwide website
EEF1G is a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This…
https://www.acris-antibodies.com/target/eef1g-antibody.htm?target=EEF1G