Loading...
*  Microbiology Society Journals | Cytomegaloviral proteins pUL50 and pUL53 are associated with the nuclear lamina and interact...
Human cytomegalovirus-encoded pUL50 and pUL53 belong to a group of conserved herpesviral nuclear proteins. This study describes: (i) the co-localization of pUL50 with components of the nuclear lamina such as lamins A/C and lamin B receptor by double immunofluorescent staining, (ii) a strong pUL50-mediated relocalization of pUL53 from a diffuse nuclear pattern towards a nuclear rim localization, (iii) a direct interaction between pUL50 and pUL53, as well as between pUL50 and protein kinase C (PKC), shown by yeast two-hybrid and co-immunoprecipitation analyses, (iv) in vitro phosphorylation of pUL50, which is highly suggestive of PKC activity, and finally (v) partial relocalization of PKC by pUL50/pUL53 from its main cytoplasmic localization to a marked nuclear lamina accumulation. These data suggest a role for pUL50 and pUL53 in the recruitment of PKC, an event that is considered to be ...
http://jgv.microbiologyresearch.org/content/journal/jgv/10.1099/vir.0.82924-0
*  "Genome-wide Maps of Nuclear Lamina Interactions in Single Human Cells" by Jop Kind, Ludo Pagie et al.
Mammalian interphase chromosomes interact with the nuclear lamina (NL) through hundreds of large lamina-associated domains (LADs). We report a method to map NL contacts genome-wide in single human cells. Analysis of nearly 400 maps reveals a core architecture consisting of gene-poor LADs that contact the NL with high cell-to-cell consistency, interspersed by LADs with more variable NL interactions. The variable contacts tend to be cell-type specific and are more sensitive to changes in genome ploidy than the consistent contacts. Single-cell maps indicate that NL contacts involve multivalent interactions over hundreds of kilobases. Moreover, we observe extensive intra-chromosomal coordination of NL contacts, even over tens of megabases. Such coordinated loci exhibit preferential interactions as detected by Hi-C. Finally, the consistency of NL contacts is inversely linked to gene activity in single cells and correlates positively with the heterochromatic ...
https://escholarship.umassmed.edu/sysbio_pubs/77/
*  Remodelling of the nuclear lamina and nucleoskeleton is required for skeletal muscle differentiation in vitro | Journal of Cell...
The nuclear lamina is a filamentous lattice that underlies the inner membrane of the nuclear envelope (NE) and provides essential mechanical support for the nucleus. In metazoan organisms, the lamina is primarily composed of type-V intermediate-filament proteins, the lamins. In higher vertebrates, lamins are divided into two subfamilies, representing seven proteins (for review, see Hutchison, 2002). The B-type lamins are housekeeping proteins that are essential for cell survival (Harborth et al., 2001). The three vertebrate B-type lamins (B1, B2 and B3) are encoded by two genes located on humen chromosomes 5q (lamin B1) (Wydner et al., 1996) and humen 19p13.3 (lamins B2 and B3) (Biamonti et al., 1992). One or more B-type lamins are expressed in all cells and tissues, and these lamins have roles in determining the size and shape of the cell nucleus (Furakawa and Hotta, 1993; Schirmer et al., 2001), and its mechanical properties (Newport et ...
http://jcs.biologists.org/content/118/2/409
*  Xist recruits the X chromosome to the nuclear lamina to enable chromosome-wide silencing | Science
The Xist lncRNA orchestrates X chromosome inactivation, a process that entails chromosome-wide silencing and remodeling of the three-dimensional structure of the X chromosome. Yet, it remains unclear whether these changes in nuclear structure are mediated by Xist and whether they are required for silencing. Here, we show that Xist directly interacts with the Lamin B Receptor (LBR), an integral component of the nuclear lamina, and that this interaction is required for Xist-mediated silencing by recruiting the inactive X to the nuclear lamina and by doing so enables Xist to spread to actively transcribed genes across the X. Our results demonstrate that lamina recruitment changes the three-dimensional structure of DNA thereby enabling Xist, and its silencing proteins, to spread across the X to silence transcription. ...
http://science.sciencemag.org/content/early/2016/08/05/science.aae0047
*  Cells | Free Full-Text | Implications for Diverse Functions of the LINC Complexes Based on the Structure
The linker of nucleoskeleton and cytoskeleton (LINC) complex is composed of the outer and inner nuclear membrane protein families Klarsicht, Anc-1, and Syne homology (KASH), and Sad1 and UNC-84 (SUN) homology domain proteins. Increasing evidence has pointed to diverse functions of the LINC complex, such as in nuclear migration, nuclear integrity, chromosome movement and pairing during meiosis, and mechanotransduction to the genome. In metazoan cells, the nuclear envelope possesses the nuclear lamina, which is a thin meshwork of intermediate filaments known as A-type and B-type lamins and lamin binding proteins. Both of lamins physically interact with the inner nuclear membrane spanning SUN proteins. The nuclear lamina has also been implicated in various functions, including maintenance of nuclear integrity, mechanotransduction, cellular ...
http://mdpi.com/2073-4409/6/1/3
*  Disassembly of the Drosophila nuclear lamina in a homologous cell-free system | Journal of Cell Science
Stage 14 Drosophila oocytes are arrested in first meiotic metaphase. A cell-free extract of these oocytes catalyzes apparent disassembly of purified Drosophila nuclei as well as of nuclear lamin polymers formed in vitro from isolated interphase lamins. Biochemically, the oocyte extract catalyzes lamin solubilization and phosphorylation as well as characteristic changes in one- and two-dimensional gel mobility. A previously unidentified soluble lamin isoform is easily seen after in vitro disassembly. This isoform is detectable but present only in very small quantities in vivo and is apparently derived specifically from one of the two interphase lamin isoforms. Cell-free nuclear lamina disassembly is ATP-dependent and addition of calcium to extracts blocks disassembly as judged both morphologically and biochemically. This system will allow enzymological characterization of cell-free lamina disassembly as well as molecular analysis of specific ...
http://jcs.biologists.org/content/108/5/2027
*  Time-resolved, in vivo studies of mitotic spindle formation and nuclear lamina breakdown in Drosophila early embryos | Journal...
Time-resolved, two-component, three-dimensional fluorescence light microscopy imaging in living Drosophila early embryos is used to demonstrate that a large fraction of the nuclear envelope lamins remain localized to a rim in the nuclear periphery until well into metaphase. The process of lamin delocalization and dispersal, typical of 'open' forms of mitosis, does not begin until about the time the final, metaphase geometry of the mitotic spindle is attained. Lamin dispersal is completed about the time that the chromosomal movements of anaphase begin. This pattern of nuclear lamina breakdown appears to be intermediate between traditional designations of 'open' and 'closed' mitoses. These results thus clarify earlier observations of lamins in mitosis in fixed Drosophila early embryos, clearly showing that the observed lamin localization does not result from a structurally defined 'spindle envelope' that persists throughout mitosis. During ...
http://jcs.biologists.org/content/109/3/591
*  PLOS Pathogens: Role for A-Type Lamins in Herpesviral DNA Targeting and Heterochromatin Modulation
Author SummaryTranscription of eukaryotic genes is regulated by sequence-specific DNA-binding proteins that bind to the DNA as well as the structure of the chromatin associated with the specific gene. Posttranslational modification of histones plays a major role in the higher order structure of the chromatin and whether it serves as heterochromatin or inactive chromatin versus euchromatin or active chromatin. The nuclear lamina has been shown to promote the maintenance of heterochromatin in mammalian cells, but little is known about where heterochromatin is modulated. In this study, we find that the A-type lamins are required for the targeting of herpes simplex virus genomic DNA to the periphery of the infected cell nucleus and for the prevention or reduction of heterochromatin on the viral genome and transcriptional silencing of the viral genome. This raises the broader function of the nuclear lamina in the regulation of both euchromatin ...
http://journals.plos.org/plospathogens/article/email?id=10.1371/journal.ppat.1000071
*  The nuclear envelope from basic biology to therapy | Biochemical Society Transactions
The nuclear envelope is composed of the nuclear membranes, nuclear pore complexes and nuclear lamina. Each of the nuclear membrane domains, inner, outer and pore, contain unique integral proteins. The pore complexes are large, macromolecular structures through which molecules ranging from ions to proteins and RNA complexes are transported between the nucleus and the cytoplasm. Using proteomics, most of the proteins of the yeast and mammalian nuclear pore complexes [1,2] and rat inner nuclear membrane [3] have been identified, but the specific functions of many of these proteins are still unknown.. The nuclear lamina appears as a fibrous-like structure on the nuclear side of the inner nuclear membrane in electron micrographs [4]. Pioneering work in the laboratory of Günter Blobel in the 1970s and 1980s led to ...
http://www.biochemsoctrans.org/content/38/1/253
*  Surprise Role of Nuclear Structure Protein in Organ Development | www.bioquicknews.com
Scientists have long held theories about the importance of proteins called B-type lamins in the process of embryonic stem cells replicating and differentiating into different varieties of cells. New research from a multi-institutional team led by the Carnegie Institution for Science's Dr. Yixian Zheng indicates that, counter to expectations, these B-type lamins are not necessary for stem cells to renew and develop, but are necessary for proper organ development. The team's work was published on November 24, 2011 in Science Express. Nuclear lamina is the material that lines the inside of a cell's nucleus. Its major structural component is a family of proteins called lamins, of which B-type lamins are prominent members and thought to be absolutely essential for a cell's survival. Mutations in lamins have been linked to a number of human diseases. Lamins are thought to suppress the expression of certain genes by binding directly to the DNA within the cell's nucleus. The role of ...
http://www.bioquicknews.com/node/694
*  lamin A/C (human)
lamin A/C nuclear lamins are intermediate filament proteins that constitute the lattice-like matrix at the inner face of the nuclear membrane that underlies the nuclear envelop. The lamins, highly conserved throughout evolution, are encoded by three genes in the human: LMNA, LMNB1, and LMNB2. The A-type lamins (lamin A/C) are developmentally regulated and are generally expressed in differentiated cells. The anchoring of chromatin to the nuclear lamina is involved in the control of gene expression and in DNA replication and repair. During mitosis, the nuclear lamina is reversibly disassembled as the lamin proteins are phosphorylated. Cleaved by caspase-6 during apoptosis into a 40-45 kDa and a28 kDa fragment. Note: This description may include information from UniProtKB ...
https://www.phosphosite.org/proteinAction.action?id=5787
*  Unique and Shared Functions of Nuclear Lamina LEM Domain Proteins in Drosophila | Genetics
Rescue of the wing patterning defect in dMAN1−/− mutants was used to assess the ability of individual Bocks isoforms or Ote to compensate for dMAN1 loss. All dMAN1−/− adults have wings with thick longitudinal veins, a variable number of anterior cross veins, branching of posterior cross veins, and folds in the blade, a phenotype not shared with the other lem-d mutants. As a control, we tested whether wing patterning defects were rescued by heat treatment of dMAN1−/−, P[hsp70:dMAN1] animals. We found that all dMAN1−/−, P[hsp70:dMAN1] adults had a normal wing phenotype, indicating that a functional level of dMAN1 protein was produced (Figure 6A). Low levels of rescue of the wing patterning defects (∼15%) were also observed in non-heat-treated dMAN1−/−, P[hsp70:dMAN1] adults, implying that basal expression of the P[hsp70:dMAN1] transgene is sufficient for phenotypic rescue. Next, we examined wing phenotypes of heat-treated and dMAN1−/−, P[hsp70:ote], dMAN1−/−, ...
http://www.genetics.org/content/197/2/653
*  Nuclear lamina assembly, synthesis and disaggregation during the cell cycle in synchronized HeLa cells | Journal of Cell Science
Marian Blanca Ramírez from the CSIC in Spain has been studying the effects of LRRK2, a protein associated with Parkinson's disease, on cell motility. A Travelling Fellowship from Journal of Cell Science allowed her to spend time in Prof Maddy Parson's lab at King's College London, learning new cell migration assays and analysing fibroblasts cultured from individuals with Parkinson's. Read more on her story here. Where could your research take you? The deadline to apply for the current round of Travelling Fellowships is 23rd Feburary 2018. Apply now!. ...
http://jcs.biologists.org/content/47/1/25
*  Xenophilia (True Strange Stuff): Aging, interrupted
Hutchinson-Gilford Progeria Syndrome is caused by a single point mutation in the gene encoding lamin A, which forms a protein scaffold on the inner edge of the nucleus that helps maintain chromatin structure and organize nuclear processes such as RNA and DNA synthesis. The mutation creates an alternative splice site that leads to the production of a truncated version of the protein known as progerin. Unlike the full-length protein, progerin does not properly integrate into the nuclear lamina, which disrupts the nuclear scaffold and causes a host of problems ...
http://xeno-lovegood.blogspot.com/2011/03/aging-interrupted.html
*  Myopathic lamin mutations impair nuclear stability in cells and tissue and disrupt nucleo-cytoskeletal coupling
Lamins are intermediate filament proteins that assemble into a meshwork underneath the inner nuclear membrane, the nuclear lamina. Mutations in the LMNA gene, encoding lamins A and C, cause a vari ...
http://www.bionity.com/en/publications/563402/myopathic-lamin-mutations-impair-nuclear-stability-in-cells-and-tissue-and-disrupt-nucleo-cytoskeletal-coupling.html
*  Volume regulation and shape bifurcation in the cell nucleus | Journal of Cell Science
The nucleus is the largest organelle in eukaryotic cells (Gundersen and Worman, 2013; Dahl et al., 2008) and contains most of the cellular genetic material. It is the site of major cellular functions, such as DNA replication, transcriptional regulation, RNA processing and ribosome maturation and assembly. The main mechanical structure that separates the nuclear content from the cytoplasm is the nuclear envelope, which is primarily composed of a double membrane and the underlying nuclear lamina (Simon and Wilson, 2011). The lamina is a network of A- and B-type lamins, and is a stable and viscoelastic material surrounding chromosomal DNA and chromatin (Beaudouin et al., 2002). It is known that the geometrical shape of the nucleus is related to many physiologically important functions of cells and, in particular, to several human diseases (Bissell et al., 1999; Zink et al., 2004; Lammerding et al., 2005; Shimi et al., 2010; ...
http://jcs.biologists.org/content/128/18/3375
*  SUN3 - SUN domain-containing protein 3 - Homo sapiens (Human) - SUN3 gene & protein
As a probable component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex, involved in the connection between the nuclear lamina and the cytoskeleton. The nucleocytoplasmic interactions established by the LINC complex play an important role in the transmission of mechanical forces across the nuclear envelope and in nuclear movement and positioning. May be involved in nuclear remodeling during sperm head formation in spermatogenenis. A probable SUN3:SYNE1 LINC complex may tether spermatid nuclei to posterior cytoskeletal structures such as the manchette.
http://www.uniprot.org/uniprot/Q8TAQ9
*  CBX3 antibody | acris-antibodies.com
At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. CBX3 binds DNA and is a component of…
https://www.acris-antibodies.com/target/cbx3-antibody.htm
*  DFG Nationallizenz: Considerations in the isolation of rat...
We have developed a simple and rapid method for isolation of purified nuclear lamina from Ehrlich ascites tumor cells. The procedure employs chromatin structures prepared from whole cells at low ionic strength and is carried out under conditions that minimize the formation of artifactual... mehr ...
http://finden.nationallizenzen.de/Record/ZDB-1-SDJ%40184331501
*  Dynamic mechanical bonding method and apparatus - Patent # 4919738 - PatentGenius
A method of and apparatus for dynamically mechanically bonding together a plurality of laminae, at least one of which comprises thermoplastic material: for example, polyethylene. In one aspect of the invention the laminae are forwarded in face to face relation through a pressure biased nip between a patterned nip defining member and an opposing nip defining member (e.g., a relief patterned cylinder and an anvil cylinder) which members are independently driven to maintain a predetermined surface velocity differential between them. In another aspect of the invention which is particularly useful at intermediate and higher line velocities--preferably for line velocities of about 300 feet or more per minute and, more preferably, for line speeds of about 450 feet or more per minute--the nip defining members may be operated with equal surface velocities. In each of these aspects of the invention, the members may be biased towards ...
http://www.patentgenius.com/patent/4919738.html
*  Proceedings of the Royal Society of London B: Biological Sciences
The centrum of C9 is opisthocoelous, with a distinct condyle. Its EI is 3, lower than that in B. brancai specimen HM SII (3.8 in C9) and Sauroposeidon (4.6 in C8; Wedel et al. 2000a). The ventral surface of the centrum is concave at its cranial half, especially in its caudal half, while the caudal half of the ventral surface is roughly flat. In lateral view, the middle portion of the centrum is concave and occupied by three fossae. The parapophysis is situated on the cranioventral corner of the centrum, and bears a short centroparapophyseal lamina along the cranial half of the central lateroventral edge.. The prezygapophysis is robust and protrudes beyond the cranial end of the central condyle as in B. brancai and Sauroposeidon (Janensch 1950; Wedel et al. 2000a). Its articular surface faces dorsomedially. The centroprezygapophyseal and the prezygodiapophyseal laminae are merged with each other and robust. They direct horizontally at its cranial portion, and ...
http://rspb.royalsocietypublishing.org/content/early/2009/09/04/rspb.2009.1278.full
*  Plant Life: Leaf Shapes
Orbicular leaves have a more or less circular leaf shape in which the width and length of the lamina are equal, or nearly so. Elliptical leaves have a shape that looks like an ellipse, twice as long as broad, with the widest part of the leaf near the middle. Oval leaves are broadly elliptical, with the blade width being more than half the length and the widest part of the leaf near the middle ...
http://lifeofplant.blogspot.com/2011/03/leaf-shapes.html
*  Frequency of LMNA, E2F4, LBR, and LMNB1 gene/RNA assoc | Open-i
Frequency of LMNA, E2F4, LBR, and LMNB1 gene/RNA associations with SC-35 domains. Nuclei were scored for association of each of the four gene/RNAs with SC-35
https://openi.nlm.nih.gov/detailedresult.php?img=PMC2132926_JCB9809045.f8&req=4
*  Lamina synonyms, lamina antonyms - FreeThesaurus.com
Synonyms for lamina in Free Thesaurus. Antonyms for lamina. 4 synonyms for lamina: membrane, sheath, sheathing, skin. What are synonyms for lamina?
http://www.freethesaurus.com/lamina
*  Protein KASH5
MDLPEGPVGGPTAEMYLRERPEEARLGMPVSLEEQILNSTFEACDPQRTGTVAVAQVLAYLEAVTGQGPQ 1 - 70 DARLQTLANSLDPNGEGPKATVDLDTFLVVMRDWIAACQLHGGLELEEETAFQGALTSRQLPSGCPEAEE 71 - 140 PANLESFGGEDPRPELQATADLLSSLEDLELSNRRLVGENAKLQRSMETAEEGSARLGEEILALRKQLHS 141 - 210 TQQALQFAKAMDEELEDLKTLARSLEEQNRSLLAQARQAEKEQQHLVAEMETLQEENGKLLAERDGVKKR 211 - 280 SQELAMEKDTLKRQLFECEHLICQRDTILSERTRDVESLAQTLEEYRVTTQELRLEISRLEEQLSQTYEG 281 - 350 PDELPEGAQLRRVGWTELLPPSLGLEIEAIRQKQEVATADLSNPLCGVWQWEEVIHETSEETEFPSEAPA 351 - 420 GGQRNFQGEPAHPEEGRKEPSMWLTRREEEEDAESQVTADLPVPLGAPRPGDIPENPPERPARRELQQAL 421 - 490 VPVMKKLVPVRRRAWGQLCLPPQRLRVTRHPLIPAPVLGLLLLLLLSVLLLGPSPPPTWPHLQLCYLQPP 491 - 560 PV 561 - 562 ...
https://pharos.nih.gov/idg/targets/Q8N6L0