Loading...
*  Human Herpesvirus 8 Disease | Pediatric Opportunistic Infection | AIDSinfo
Human herpesvirus 8 (HHV-8), also called Kaposi sarcoma (KS)-associated herpesvirus (KSHV), is a gamma human herpesvirus most ... A Review of Human Herpesvirus 8, the Kaposi's Sarcoma-Associated Herpesvirus, in the Pediatric Population. J Pediatric Infect ... Blood-borne and sexual transmission of human herpesvirus 8 in women with or at risk for human immunodeficiency virus infection ... Human herpesvirus 8-associated hemophagocytic lymphohistiocytosis in human immunodeficiency virus-infected patients. Clin ...
https://aidsinfo.nih.gov/guidelines/html/5/pediatric-oi-prevention-and-treatment-guidelines/407/human-herpesvirus-8-disease
*  Transgenic Expression of the Chemokine Receptor Encoded by Human Herpesvirus 8 Induces an Angioproliferative Disease Resembling...
2) discovered a novel human herpesvirus (human herpesvirus 8 [HHV8], or KS-associated herpesvirus [KSHV]) during systematic DNA ... Human herpesvirus 8 (HHV8, also known as Kaposi's sarcoma [KS]-associated herpesvirus) has been implicated as an etiologic ... 1997) Human herpesvirus KSHV encodes a constitutively active G-protein-coupled receptor linked to cell proliferation. Nature. ... 1998) Transformation of primary human endothelial cells by Kaposi's sarcoma-associated herpesvirus. Nature. 394:588-592, pmid: ...
http://jem.rupress.org/content/191/3/445
*  Piracy of Prostaglandin E2/EP Receptor-Mediated Signaling by Kaposi's Sarcoma-Associated Herpes Virus (HHV-8) for Latency Gene...
Spectrum of Kaposi's sarcoma-associated herpesvirus, or human herpesvirus 8, diseases. Clin Microbiol Rev 2002;15:439-64. ... Kaposi's sarcoma-associated herpesvirus/human herpesvirus 8 envelope glycoprotein gB induces the integrin-dependent focal ... Characterization and cell cycle regulation of the major Kaposi's sarcoma-associated herpesvirus (human herpesvirus 8) latent ... Kaposi's sarcoma-associated herpesvirus induces sustained NF-κB activation during de novo infection of primary human dermal ...
http://cancerres.aacrjournals.org/content/70/9/3697.long
*  A case report of immunosuppression-related Kaposi's sarcoma after autologous stem cell transplantation | BMC Research Notes |...
The emergence of Kaposi's sarcoma-associated herpesvirus (human herpesvirus 8). N Engl J Med. 2000;343:1411-3.View Article ... The driving agent for the proliferative growth is Kaposi's sarcoma-associated herpes virus (KSHV) also known as Human herpes ... Human herpesvirus 8 detection in nasal secretions and saliva. J Infect Dis. 1998;177:213-6.View ArticlePubMedGoogle Scholar. ... Human herpes virus 8 in solid organ transplantation. Transplantation. 2011;92(8):837-44.View ArticlePubMedGoogle Scholar. ...
https://0-bmcresnotes-biomedcentral-com.brum.beds.ac.uk/articles/10.1186/s13104-016-1991-9
*  Herpesviridae | Qjure
Cercopithecine herpesvirus-1, herpesvirus simiae) is a simplexvirus endemic in macaque monkeys. Human zoonotic infection with ... Human herpesviridae. HHV-1 = HSV-1 (herpes simplex virus 1): causes oral and/or genital herpes (predominantly orofacial); B ... HHV-8 = a type of rhadinovirus = KSHV = Kaposi's sarcoma-associated herpesvirus: causes Kaposi's sarcoma, primary effusion ... HHV-3 = VZV (varicella zoster virus): causes chickenpox and shingles. HHV-4 = EBV (Epstein-Barr virus), lymphocryptovirus: ...
http://www.qjure.com/remedy/herpesviridae
*  MMP2 - Structure of Rhomboid Protease in Complex with β-Lactam Inhibitors
Kaposi's sarcoma-associated herpesvirus (KSHV) bears four genes with homology to human. Kaposi's sarcoma-associated herpesvirus ... Intro Kaposi's sarcoma-associated herpesvirus (KSHV) also termed human being herpesvirus 8 (HHV-8) belongs to the ... however in humans MHC II expression is usually inducible by gamma interferon (IFN-γ) in almost every cell type (44). The class ... KSHV) bears four genes with homology to human being interferon regulatory factors (IRFs). PEL cell lines resulted in improved ...
http://rectalcancersite.com/tag/mmp2/
*  Background Kaposi sarcoma-associated herpesvirus (KSHV) is the etiologic agent of primary - Aurora Kinases as Druggable Targets...
Arsenic trioxide (arsenic) is a very effective treatment of acute promyelocytic leukemia (APL) [48C54]. Similarly, in human T ... Background Kaposi sarcoma-associated herpesvirus (KSHV) is the etiologic agent of primary effusion lymphomas (PEL). Herpesvirus ... Background Kaposi sarcoma-associated herpesvirus (KSHV) is the etiologic agent of primary. February 10, 2018. GABA Transporters ... similar to most herpesviruses, exhibits two different types of cycles: a latent and a lytic infection cycle. Generally, KSHV ...
http://www.exposed-skin-care.net/2018/02/10/background-kaposi-sarcoma-associated-herpesvirus-kshv-is-the-etiologic-agent-of-primary/
*  UPENN Biomedical Graduate Studies | Yan Yuan
Kaposi's sarcoma-associated herpesvirus (KSHV) is a newly-identified human herpesvirus and an emerging pathogen. Increasing ... Kaposi's sarcoma-associated herpesvirus. Key words: Kaposi's sarcoma-associated herpesvirus, virus-host interaction, microRNAs. ... Lin, C., Li, H., Wang, Y, Kudchodkar, S., Zhu, F. X. and Yuan, Y. (2003) Kaposi's sarcoma-associated herpesvirus ori-Lyt- ... Wang, Y., Li, H., Hollow, C. and Yuan, Y. (2008) Kaposi's Sarcoma-associated Herpesvirus ori-Lyt-dependent DNA Replication: ...
http://www.med.upenn.edu/apps/faculty/index.php/g20000220/p4485294
*  An AIDS-Related Virus Reveals More Ways to Cause Cancer, Penn Researchers Find - PR News
"Whether these latent herpes viruses use some of the same strategies that we have found for LANA in KSHV has not been determined ... This new role for LANA was discovered using specific human cell lines. The next step is to test whether LANA works the same way ... Other herpes viruses, such as the one that causes cold sores and Epstein-Barr virus, which causes mononucleosis, are able to ... Researchers at the University of Pennsylvania School of Medicine have shed new light on how Kaposi's Sarcoma-associated Herpes Virus ...
https://www.pennmedicine.org/news/news-releases/2007/october/an-aidsrelated-virus-reveals-m
*  ORBi: Browsing ORBi
The best studied gammaherpesviruses are Human herpesvirus 4 and Human herpesvirus 8. As these viruses have no well-established ... The known human gamma-herpesviruses (Epstein-Barr virus and Kaposi's Sarcoma-associated Herpesvirus) are host-specific and ... The known human gamma-herpesviruses (Epstein-Barr virus and Kaposi's Sarcoma-associated Herpesvirus) are host-specific and ... This makes related animal gamma-herpesviruses an important source of information. We are studying Murid herpesvirus 4 (MuHV-4 ...
https://orbi.uliege.be/browse?type=author&value=Sarlet,%20Micha%C3%ABl%20p002423
*  Treatment of Kaposi Sarcoma, Kaposi's Sarcoma, Kaposi's Sarcoma Definition, Causes, Risk Factors, Symptoms, Diagnosis &...
However, recent evidence shows a strong link between KS and a sexually transmitted virus, human herpes virus 8 (HHV8), in AIDS ... Generally, radiation therapy is delivered once or in divided doses over 2-3 weeks. The number of radiation treatments necessary ...
http://www.knowyourdisease.com/treatment-of-kaposis-sarcoma.html
*  Human herpesvirus 3 ATCC ® VR-1367D™
... Designation: DNA from VZV strain Ellen [ATCC ® VR-1367™] Application: It is appropriate ... Quantitative Genomic DNA from Human herpesvirus 3 (HHV-3) (ATCC® VR-1367DQ™) Add to ... infected with Human herpesvirus 3 (VZV) strain Ellen (ATCC VR-1367). Contact Technical Service if lot-specific concentration ...
https://www.atcc.org/en/Products/Nucleic_Acid_Proteins_and_Cell_Extracts/Genomic_DNA_and_RNA/From_Virus/VR-1367D.aspx
*  UL11 - Cytoplasmic envelopment protein 3 - Human herpesvirus 1 (strain 17) (HHV-1) - UL11 gene & protein
Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1). ... Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1) ... Viruses › dsDNA viruses, no RNA stage › Herpesvirales › Herpesviridae › Alphaherpesvirinae › Simplexvirus › Human herpesvirus 1 ... Human herpesvirus 1 (strain 17) OX=10299 GN=UL11 PE=1 SV=3 MGLSFSGARPCCCRNNVLITDDGEVVSLTAHDFDVVDIESEEEGNFYVPPDMRGVTRAPG ...
https://www.uniprot.org/uniprot/P04289
*  TRM3 - Tripartite terminase subunit 3 - Human herpesvirus 1 (strain 17) (HHV-1) - TRM3 gene & protein
Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1). Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes ... Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1). Human herpesvirus 2 (HHV-2) (Human herpes simplex virus ... Human herpesvirus 2 (HHV-2) (Human herpes simplex virus 2). Human herpesvirus 2 (strain 186) (HHV-2) (Human herpes simplex ... Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2). Human herpesvirus 2 (strain 186) (HHV-2) (Human ...
http://www.uniprot.org/uniprot/P04295
*  Herpesvirus 3, Human | Anatomical Neuropharmacology Unit
This is an historical archive of the activities of the MRC Anatomical Neuropharmacology Unit (MRC ANU) that operated at the University of Oxford from 1985 until March 2015. The MRC ANU established a reputation for world-leading research on the brain, for training new generations of scientists, and for engaging the general public in neuroscience. The successes of the MRC ANU are now built upon at the MRC Brain Network Dynamics Unit at the University of Oxford.. ...
http://mrcanu.pharm.ox.ac.uk/research-and-techniques/herpesvirus-3-human
*  Varicella (Human Herpes Virus-3) Vaccine Potential Role Against Herpes (HSV-1/HSV-2) Viruses to Prevent HIV-1 Pandemic in Sub-...
Human Herpes Virus-3) Vaccine Potential Role Against Herpes (HSV-1/HSV-2) Viruses to Prevent HIV-1 Pandemic in Sub- Saharan ... Varicella (Human Herpes Virus-3) Vaccine Potential Role Against Herpes (HSV-1/HSV-2) Viruses to Prevent HIV-1 Pandemic in Sub- ... Jacqueline Le Goaster1, *, Patrice Bourée1, Franck N. El Sissy1, Johanna Pokossy Epee1, Frédéric Tangy2, Anne-Lise Haenni3, ... They induce an extensive immune deficiency with other herpes viruses such as HHV-4 and HHV-8, which are linked to lymphomas and ...
https://benthamopen.com/ABSTRACT/TOIDJ-10-116
*  A Study of the Safety and Effectiveness of a Chickenpox Vaccine in HIV-Infected Children - Full Text View - ClinicalTrials.gov
Herpesvirus 3, Human. Viral Vaccines. AIDS-Related Complex. Vaccines, Attenuated. Chickenpox. Chickenpox Vaccine. ... Eunice Kennedy Shriver National Institute of Child Health and Human Development (NICHD) ... Eunice Kennedy Shriver National Institute of Child Health and Human Development (NICHD) ... If a child had a lower CD4 count before this time, then he/she must have been on stable anti-HIV therapy for the past 3 months. ...
https://clinicaltrials.gov/ct2/show/study/NCT00000837?view=results
*  Publications [#278745] of Dennis A. Clements
HumanHumans • Immunization Schedule • Infant • Male • Prognosis • Severity of Illness Index • Time Factors • Viral Vaccines ... Herpesvirus 3, ...
https://fds.duke.edu/db/Provost/clacs/faculty/cleme002/publications/278745
*  The Big Picture Book of Viruses - Baltimore Listing
human herpesvirus 5. Vertebrates. Muromegalovirus. mouse cytomegalovirus 1. Vertebrates. Roseolovirus. human herpesvirus 6. ... human spumavirus. Vertebrates. Back to Top. Group VII: DNA Reverse Transcribing Viruses. [ Family:, (Subfamily:), Genus, Type ...
http://www.virology.net/Big_Virology/BVFamilyGroup.html
*  HIV-positive | definition of HIV-positive by Medical dictionary
The herpesvirus that causes chickenpox and shingles.. Synonym: human herpesvirus 3. VECTOR OF WEST NILE VIRUS: The Culex ... Abbreviation for human immunodeficiency virus.. HIV. human immunodeficiency virus.. HIV. (āch′ī-vē′). n.. A retrovirus of the ... human T-cell lymphotropic virus type III. Abbreviation: HTLV-III. The former name for human immunodeficiency virus (HIV). ... herpes virus. See: herpesvirus. EFFECT OF HIV ON IMMUNE SYSTEM: HIV contains several proteins: gp 120 protein around it and ...
http://medical-dictionary.thefreedictionary.com/HIV-positive
*  HDV | definition of HDV by Medical dictionary
The herpesvirus that causes chickenpox and shingles.. Synonym: human herpesvirus 3. VECTOR OF WEST NILE VIRUS: The Culex ... human T-cell lymphotropic virus type III. Abbreviation: HTLV-III. The former name for human immunodeficiency virus (HIV). ... herpes virus. See: herpesvirus. EFFECT OF HIV ON IMMUNE SYSTEM: HIV contains several proteins: gp 120 protein around it and ... human papilloma virus. See: papillomavirus. human T-cell lymphotropic virus type I. Abbreviation: HTLV-I. A virus associated ...
https://medical-dictionary.thefreedictionary.com/HDV
*  Virus varicella-zoster - Wikipedia bahasa Indonesia, ensiklopedia bebas
Human herpesvirus 3 (HHV-3). Virus varicella-zoster adalah virus penyebab cacar air dan cacar ular (herper zoster).[1] Inang ... Clinical Microbiology Reviews 9 (3): 361-381. Diakses tanggal 13 Juni 2010. Cite uses deprecated parameter ,month=. (bantuan) ...
https://id.wikipedia.org/wiki/Virus_varicella-zoster
*  The future of varicella vaccine.
Human / immunology*. Humans. Immune Tolerance. Immunosuppression. Infant. Vaccination / trends. Viral Vaccines*. ... Herpesvirus 3, ...
http://www.biomedsearch.com/nih/future-varicella-vaccine/3014474.html
*  Catalent Pharma Solutions Llc Product News and Research | CureHunter
Human Herpesvirus 3, Agaricales, Triticum, Abelmoschus, Cucurbita, Cucumis melo, Pastinaca, Petroselinum, Cuminum, Musa, Apium ... human GAA protein (Myozyme), Polysorbates (PSML), peginterferon alfa-2a (Pegasys), Sodium Hydroxide (Caustic Soda), rituximab ( ... 18 human papillomavirus vaccine L1 (Gardasil), Cannabis, Candida albicans, Capsicum, rosin (pine resin), diphenylguanidine, ... human DNASE1 protein (dornase alfa), abciximab (ReoPro), rilonacept, palivizumab, adalimumab (Humira), platelet-derived growth ...
http://www.curehunter.com/public/fdaFirmSearch011014-Catalent-Pharma-Solutions-Llc.do
*  PPT - Introduction to Herpes Viruses PowerPoint Presentation - ID:1797707
Human Herpesvirus 4 HHV4 * Epstein-Barr EBV or EB *Human Herpesvirus 6 -HHV6 ... Herpes Viruses. Group characteristics Herpes simplex 1 Herpes simplex 2. VP26 Assembly in HSV-1 Capsid. Herpes Virus Outline. ... ALL herpes viruses can establish latent infections. The viral genome may become incorporated into the host DNA or remain ... PowerPoint Slideshow about 'Introduction to Herpes Viruses' - kato. An Image/Link below is provided (as is) to download ...
https://www.slideserve.com/kato/introduction-to-herpes-viruses