Loading...
*  CYGB - Cytoglobin - Homo sapiens (Human) - CYGB gene & protein
IPR000971 Globin. IPR009050 Globin-like_sf. IPR012292 Globin/Proto. IPR013314 Globin_lamprey/hagfish. ... IPR000971 Globin. IPR009050 Globin-like_sf. IPR012292 Globin/Proto. IPR013314 Globin_lamprey/hagfish. ... GlobinAdd BLAST. 151. ,p>This subsection of the 'Family and domains' section provides information about the sequence similarity ... Belongs to the globin family.PROSITE-ProRule annotation. Manual assertion according to rulesi ...
https://www.uniprot.org/uniprot/Q8WWM9/
*  Ngb - Neuroglobin - Mus musculus (Mouse) - Ngb gene & protein
Hexacoordinate globin, displaying competitive binding of oxygen or the distal His residue to the iron atom. Not capable of ... GlobinAdd BLAST. 149. ,p>This subsection of the 'Family and domains' section provides information about the sequence similarity ... Hexacoordinate globin, displaying competitive binding of oxygen or the distal His residue to the iron atom. Not capable of ... Belongs to the globin family.PROSITE-ProRule annotation. ,p>Manual validated information which has been generated by the ...
https://www.uniprot.org/uniprot/Q9ER97
*  HBQ1 - Hemoglobin subunit theta-1 - Homo sapiens (Human) - HBQ1 gene & protein
IPR000971 Globin. IPR009050 Globin-like_sf. IPR012292 Globin/Proto. IPR002338 Haemoglobin_a-typ. IPR002339 Haemoglobin_pi. ... IPR000971 Globin. IPR009050 Globin-like_sf. IPR012292 Globin/Proto. IPR002338 Haemoglobin_a-typ. IPR002339 Haemoglobin_pi. ... Belongs to the globin family.PROSITE-ProRule annotation. ,p>Manual validated information which has been generated by the ...
https://www.uniprot.org/uniprot/P09105
*  MAFG - Transcription factor MafG - Homo sapiens (Human) - MAFG gene & protein
Activates globin gene expression when associated with NFE2L2 (PubMed:11154691). May be involved in signal transduction of ... Activates globin gene expression when associated with NFE2L2 (PubMed:11154691). May be involved in signal transduction of ...
http://www.uniprot.org/uniprot/O15525
*  NFE2 - Transcription factor NF-E2 45 kDa subunit - Homo sapiens (Human) - NFE2 gene & protein
May play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron. ... Binds to the hypersensitive site 2 (HS2) of the beta-globin control region (LCR). This subunit (NFE2) recognizes the TCAT/C ... May play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron.2 Publications. , ... PXY1 is required to promote transactivation of beta-globin and for hyperacetylation of histone H3, but not for binding to the ...
http://www.uniprot.org/uniprot/Q16621
*  Globin-F1 - Eptatretus burgeri (Inshore hagfish)
Belongs to the globin family.PROSITE-ProRule annotation. ,p>Manual validated information which has been generated by the ... sp,Q7SID0,GLBF1_EPTBU Globin-F1 OS=Eptatretus burgeri PE=1 SV=1 PIIDQGPLPTLTDGDKKAINKIWPKIYKEYEQYSLNILLRFLKCFPQAQASFPKFSTKKS ...
http://www.uniprot.org/uniprot/Q7SID0
*  Globin - Lampetra fluviatilis (European river lamprey)
Belongs to the globin family.PROSITE-ProRule annotation. ,p>Manual validated information which has been generated by the ... sp,P02207,GLB_LAMFL Globin OS=Lampetra fluviatilis OX=7748 PE=1 SV=2 ...
http://www.uniprot.org/uniprot/P02207
*  Globin - Lampetra fluviatilis (European river lamprey)
IPR000971 Globin. IPR009050 Globin-like_sf. IPR012292 Globin/Proto. IPR013314 Globin_lamprey/hagfish. ... IPR000971 Globin. IPR009050 Globin-like_sf. IPR012292 Globin/Proto. IPR013314 Globin_lamprey/hagfish. ... Belongs to the globin family.PROSITE-ProRule annotation. Manual assertion according to rulesi ... sp,P02207,GLB_LAMFL Globin OS=Lampetra fluviatilis OX=7748 PE=1 SV=2 ...
https://www.uniprot.org/uniprot/P02207
*  Extracellular globin-3 precursor - Lumbricus terrestris (Common earthworm)
Extracellular globin-3Add BLAST. 153. Amino acid modifications. Feature key. Position(s). DescriptionActions. Graphical view. ... "Two globin strains in the giant annelid extracellular haemoglobins.". Gotoh T., Shishikura F., Snow J.W., Ereifej K.I., ... Belongs to the globin family.PROSITE-ProRule annotation. ,p>Manual validated information which has been generated by the ... sp,P11069,GLB3_LUMTE Extracellular globin-3 OS=Lumbricus terrestris OX=6398 PE=1 SV=3 ...
http://www.uniprot.org/uniprot/P11069
*  NR2C2 - Nuclear receptor subfamily 2 group C member 2 - Homo sapiens (Human) - NR2C2 gene & protein
... complex that represses embryonic and fetal globin transcription including that of GATA1. Binds to hormone response elements ( ... binds DNA as a heterodimer with NR2C1 required for chromatin remodeling and for binding to promoter regions such as globin DR1 ... complex that represses embryonic and fetal globin transcription including that of GATA1. Binds to hormone response elements ( ...
http://www.uniprot.org/uniprot/P49116
*  KRT7 - Keratin, type II cytoskeletal 7 - Homo sapiens (Human) - KRT7 gene & protein
"Translational regulation of human papillomavirus type 16 E7 mRNA by the peptide SEQIKA, shared by rabbit alpha(1)-globin and ... "Translational regulation of human papillomavirus type 16 E7 mRNA by the peptide SEQIKA, shared by rabbit alpha(1)-globin and ... "Translational regulation of human papillomavirus type 16 E7 mRNA by the peptide SEQIKA, shared by rabbit alpha(1)-globin and ...
http://www.uniprot.org/uniprot/P08729
*  DLX4 - Homeobox protein DLX-4 - Homo sapiens (Human) - DLX4 gene & protein
"BP1, a homeodomain-containing isoform of DLX4, represses the beta-globin gene.". Chase M.B., Fu S., Haga S.B., Davenport G., ... "BP1, a homeodomain-containing isoform of DLX4, represses the beta-globin gene.". Chase M.B., Fu S., Haga S.B., Davenport G., ...
https://www.uniprot.org/uniprot/Q92988
*  MBD2 - Methyl-CpG-binding domain protein 2 - Homo sapiens (Human) - MBD2 gene & protein
"p66Alpha-MBD2 coiled-coil interaction and recruitment of Mi-2 are critical for globin gene silencing by the MBD2-NuRD complex." ... "Heterogeneous nuclear ribonucleoprotein C1/C2, MeCP1, and SWI/SNF form a chromatin remodeling complex at the beta-globin locus ... "Heterogeneous nuclear ribonucleoprotein C1/C2, MeCP1, and SWI/SNF form a chromatin remodeling complex at the beta-globin locus ...
https://www.uniprot.org/uniprot/Q9UBB5