Pei-Hui Lin, PhD | Ohio State College of Medicine
Annexin A1, and Mitsugumin 53 Are Upregulated in Muscular Dystrophy and Localize to Longitudinal Tubules of the T-System With ... "Enhancing Muscle Membrane Repair by Gene Delivery of MG53 Ameliorates Muscular Dystrophy and Heart Failure in delta-Sarcoglycan ... store-operated Ca2+ entry and altered Ca2+ release from sarcoplasmic reticulum through silencing of junctophilin genes." ...
Gene Index - A14
Annexin a1 - APOBEC3A , APOBEC3A/B - ARHGAP40 , ARHGAP42 - ARPC2 , ARPC3 - ASTL , Astrotactin 2 - ATP5G3 , ATP5H - Azurocidin ... Annexin a1 - APOBEC3A APOBEC3A/B - ARHGAP40 ARHGAP42 - ARPC2 ARPC3 - ASTL Astrotactin 2 - ATP5G3 ATP5H - Azurocidin ... Browse our products by gene A1BG - ABI3 , ABI3BP - ACSS3 , ACTBL2 - ADARB2-AS1 , ADAT1 - AFF4 , AFG3L2 - AKAP5 , AKAP6 - ALOX8/ ...
Human ANXA10 (Annexin A10) recombinant protein - Protein Alternatives
Gene information:. Gene name: Annexin A10. Gene symbol: ANXA10. Organism: Homo sapiens. GenBank accession: NM_007193.3. Protein ... Alternative names and symbols: annexin 14; ANX14. Related products: Rabbit anti Annexin A10 polyclonal antibody [AB-10007]. ... Human ANXA1 (Annexin A1) recombinant protein €97,00. - €3.230,00. SKU: PRO-50026 ...
Human IL8 (77aa residues) (Interleukin 8) recombinant protein - Protein Alternatives
Stanley Nelson | UCLA Profiles
Loss of annexin A1 expression in human breast cancer detected by multiple high-throughput analyses. Biochem Biophys Res Commun ... Linkage, association, and gene-expression analyses identify CNTNAP2 as an autism-susceptibility gene. Am J Hum Genet. 2008 Jan ... Cartilage-selective genes identified in genome-scale analysis of non-cartilage and cartilage gene expression. BMC Genomics. ... Annexin A6 modifies muscular dystrophy by mediating sarcolemmal repair. Proc Natl Acad Sci U S A. 2014 Apr 22; 111(16):6004-9. ...
Cancers | Free Full-Text | Cytoskeletal Dynamics in Epithelial-Mesenchymal Transition: Insights into Therapeutic Targets for...
PPARgamma Ligand-induced Annexin A1 Expression Determines Chemotherapy Response via Deubiquitination of Death Domain Kinase RIP ... and TWIST that curb gene expression (listed in the blue box) related with the epithelial state and induce expression of genes ... and TWIST that curb gene expression (listed in the blue box) related with the epithelial state and induce expression of genes ... Genes Dev. 2007, 21, 1581-1597. [Google Scholar] [CrossRef][Green Version]. *Kim, S.; Kellner, J.; Lee, C.H.; Coulombe, P.A. ...
iNOS Monoclonal Antibody (CXNFT), Alexa Fluor™ 700 (56-5920-82)
...
Annexin A1 protects against cerebral ischemia-reperfusion injury by modulating microglia/macrophage polarization via FPR2/ALX- ... There are three isoforms of NOS that are encoded by three separate genes. NOS1 (neuronal NOS, nNOS) and NOS3 (endothelial NOS, ... Gene Aliases: i-NOS; iNOS; Inosl; Nos-2; NOS-II; Nos2; Nos2a ... Oligos, Primers, Probes and Genes * TaqMan Real-Time PCR Assays ... negative regulation of gene expression peptidyl-cysteine S-nitrosylation positive regulation of guanylate cyclase activity ...
September 2021 - Recent Advances in the Discovery and Development of MCL-1 inhibitors
... bafilomycin A1 (Calbiochem, US), annexin V- fluorescein isothiocyanate (FITC), and apoptosis recognition Package (BD Bioscience ... HMGA2 gene was cloned by RTCPCR from total RNA of senescent WI38 cells. The amplified PLA2G10 PCR item was inserted in to the ... Harmine can down-regulation the appearance of pro-metastatic genes (e.g. MMP-9, ERK and VEGFs) which relates to this activity, ... WI38 cells stably expressing alien genes transduced by lentivirus had been seeded in 96-well plates at a thickness around LGB- ...
Role of extracellular RNA-carrying vesicles in cell differentiation and reprogramming. - Unicyte
Annexin A1-containing extracellular vesicles and polymeric nanoparticles promote epithelial wound repair. J Clin Invest. 2015; ... Enhanced expression of miRNA that regulates early ocular genes and genes relevant for retina remodeling and protection, and the ... EVs containing annexin A1 were shown to activate wound regeneration circuits able to repair chronic mucosal injury [105].. ... Changes in gene expression induced in retinal Muller cells by EVs from embryonic stem cells have also been ascribed to miRNA ...
产品中心-北京博奥森生物技术有
TCEA3 promotes differentiation of C2C12 cells via an Annexin A1‐mediated transforming growth factor‐β signaling pathway. J Cell ... The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene ... Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD2/SMAD4 ... Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, May 2012].. Function:. ...
Sarah Marshall - Outputs - Monash University
The novel small-molecule annexin-a1 mimetic, compound 17b, elicits vasoprotective actions in streptozotocin-induced diabetic ... Silencing of Nrf genes in the human placenta as measured by SDS-PAGE and Western Blotting techniques. Yap, Y. W., Hannan, N. J. ... Relaxin deficiency results in increased expression of angiogenesis- and remodelling-related genes in the uterus of early ...
Euro</strong>
There are at least ten different annexins in mammalian species. Annexins do not contain signal peptides, yet some annexins (A1 ... This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a ... Annexin A2. UniProt Synonym Protein Names:. Annexin II; Annexin-2; Calpactin I heavy chain; Calpactin-1 heavy chain; ... annexin A2; annexin-2; protein I; annexin II; lipocortin II; chromobindin 8; chromobindin-8; calpactin I heavy chain; calpactin ...
Diagnosis of Hairy Cell Leukemia and HCL-like Disorders: Pitfalls to Avoid and the need to Integrate Molecular Data
Annexin A1- but CD10+ hairy cell leukemia. Blood 139 (2022): 1924.. *Salem DA, Scott D, McCoy CS, et al. Differential ... Twenty-four per-cent of patients with SDRPL presented mutations in CCND3 and/or recurrent mutations or losses in BCOR (gene ... A patient with CD10 expression without annexin A1 was recently also reported [11]. The differences observed between the ... The mutation replaces Thymine (T) with adenine (A) in exon 15 of BRAF at position 1799 of the gene coding sequence located in ...
S100A10 | Cancer Genetics Web
Comparing gene expression profiles of HT-29 and HT-29R cells, we identified the S100A10/Annexin A2 complex and calpain 2 as ... S100A6, S100A11 and its putative interaction partner annexin A1 showed the highest overexpression in PTC compared to normal ... Silencing of the annexin II gene down-regulates the levels of S100A10, c-Myc, and plasmin and inhibits breast cancer cell ... ANXA2 and S100A10 gene expressions were assessed in publicly available ovarian cancer data sets and annexin A2 and S100A10 ...
Intercellular transfer of mitochondrial DNA carrying metastasis-enhancing pathogenic mutations from high- to low-metastatic...
5b). The microvesicle marker protein annexin A1 in both P29 and A11 S-EV fractions (Fig. 5c) were absent in immunoblots. Among ... a) Location of the genes in mtDNA used for PCR analysis. (b) Presence of various mtDNA genes (ND1, ND4, ND6, COI, HVR) in A11 S ... L-EVs include microvesicles that are 100- to 1000-nm, featured by a high content of annexin A1, and encapsulate mitochondria ... Annexin A1, CD9, CD63, CD81, GAPDH, LC3B, β-actin, Lamin A/C and mitochondrial proteins were detected by Western blot analyses ...
SZGR2
Schizophrenia Gene Resource, SZGR, SZ, SCZ, database, resource, UTHealth, SBMI, SZDB,Schizophrenia Gene Database, Zhongming ... annexin A1. 9q21.13. CV:GWAScat. CV:GWASdb. CV:PGCnp. GO_Annotation. PMID:cooccur. STRUCTURAL PLASTICITY. G2Cdb.human_BAYES- ... Because the gene page contains a lot of information, it takes on average 3-5 seconds to load. So when you click a gene ID, ... Search results: The pahtway p1357 has 351 genes in the original annotation. Currently, there are 230 genes in SZGR 2.0 (with ...
Browsing Cell and Molecular Biology by Title
Biologia dei sistemi
Role of Annexin A1 in tumor progression Belvedere, Raffaella (Universita degli studi di Salerno, 2016-10-06) ... Transcriptional regulation of biosynthetic genes of the plant MEP-derived pathway to boost the metabolic flux towards bioactive ... Annexin 1 (ANXA1) is a multifunctional protein of 37 kDa, and represents the first characterized member of the annexin ...
KAKEN - Research Projects | Elucidation of structure and function of heterochromatin (KAKENHI-PLANNED-25116004)
Journal Article] An annexin A1-FPR1 interaction contributes to necroptosis of keratinocytes in severe cutaneous adverse drug ... Journal Article] Histone H4 lysine 20 acetylation is associated with gene repression in human cells.2016. *. Author(s). Kaimori ... Journal Article] Defects in dosage compensation impact global gene regulation in the mouse trophoblast2017. *. Author(s). ...
sp|Q9NRG9|AAAS HUMAN Aladin OS=Homo sapiens GN=AAAS PE=1 SV=1
HUMAN Annexin A1 OS=Homo sapiens GN=ANXA1 PE=1 SV=2 MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGV ... HUMAN Calcitonin gene-related peptide type 1 receptor OS=Homo sapiens GN=CALCRL PE=1 SV=2 ... HUMAN Adenosine receptor A1 OS=Homo sapiens GN=ADORA1 PE=1 SV=1 MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA ... HUMAN Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein OS=Homo sapiens GN=ALS2CR12 PE=1 SV=2 ...
CUI DEVELOPING HEART C7 MAST CELL
annexin A1 [Source:HGNC Sy.... ARHGAP15. 55843. ARHGAP15. Rho GTPase activating prot.... ... Gene families ?. Categorize these 156 genes by gene family Show members. (show 156 source identifiers mapped to 156 genes) ... Clustering Information and Differentially Expressed Genes, Related to Figure 1.. Related gene sets. (show 24 additional gene ... CGN: Cancer Gene Neighborhoods CM: Cancer Modules C5: Ontology GO: Gene Ontology GO:BP: GO Biological Process GO:CC: GO ...
African-American esophageal squamous cell carcinoma expression profile reveals dysregulation of stress response and detox...
To determine whether certain genes are uniquely altered in African-American ESCC we performed a meta-analysis of ESCC ... potentially representing key genes in African-American esophageal squamous carcinogenesis. Loss of activity of drug ... We found significant dysregulation of genes encoding drug-metabolizing enzymes and stress response components of the NRF2- ... aldehyde dehydrogenase 7 family member A1. ANXA7:. Annexin 7. ARE:. antioxidant/electrophile response element ...
Saez-Rodriguez Group
Tudor staphylococcal nuclease drives chemoresistance of non-small cell lung carcinoma cells by regulating S100A11 | Oncotarget
In cell cytoplasm S100A11 was reported to interact with Annexin A1 and Annexin A2 [26, 27], known to inhibit phospholipases A2 ... Gene expression analysis and target gene selection. To determine candidate genes, whose expression is altered upon TSN ... In cytoplasm, S100A11 can interact with calcium- and phospholipid-binding proteins Annexin A1 and Annexin A2, known to inhibit ... 5). Thus, inhibition of cPLA2 by Annexin A1 was shown to be more effective [27] when it is complexed with S100A11, although ...
miRNA deregulation has been implicated in the pathogenesis of mantle cell - Research of The MDM2-p53 pathway
Previous Post: Introduction Annexin A1 (ANXA1) is an anti-inflammatory proteins reported to play ... Furthermore, our and data showed a synergistic anticancer effect of chemical inhibitors for specific genes in these two ... Nonetheless, small subsets of individuals (< 5%) lack this genetic aberration but show an almost indistinguishable gene- ... and associated with high proliferation gene signature. The other clusters demonstrated enrichment of stroma-associated miRNAs, ...
業績一覧 | 感染制御学分野
Identification of annexin A1 as a novel substrate for E6AP-mediated ubiquitylation. Journal of Cellular Biochemistry, 106, 1123 ... Minami N, Abe T, Deng L, Matsui C, Fukuhara T, Matsuura Y, and Shoji I. Unconjugated interferon-stimulated gene 15 specifically ... Abe T, Marutani Y, Deng L, Matsui C, Fukasawa M, Suzuki R, Wakita T, Matsuura Y, Shoji I. Hepatitis C virus disrupts Annexin 5- ... Matsui, C., Shoji, I., Kaneda, S., Sianipar, IR., Deng, L., and Hotta, H. Hepatitits C virus infection suppresses GLUT2 gene ...
Time-dependent specific molecular signatures of inflammation and remodelling are associated with trimethylamine-N-oxide (TMAO)...
... and Kyoto Encyclopedia of Genes and Genomes (KEGG) pathways were modulated after a short (24H) compared to a long (48H) ... Marshall, S. A. et al. The novel small-molecule annexin-a1 mimetic, compound 17b, Elicits Vasoprotective actions in ... was used as the reference housekeeping gene. Relative gene expression was calculated using the 2-ΔΔCT method, where gene ... Marshall, S. A. et al. The novel small-molecule annexin-a1 mimetic compound elicits vasoprotective actions in streptozotocin- ...
Original Paper | 公益財団法人サントリー生命科学財
"Annexin A1 Accounts for an Anti-Inflammatory Binding Target of Sesamin Metabolites" NPJ Sci Food 4, 4 (2020). [Publisher] (open ... Genes Evol. 222, 217-227. [PubMed] open access. Suzuki, N., Sekiguchi, T., Satake, H., Kato, K., Nishiyama, Y., Takahashi, H., ... Bahabadi, S.E., Sharifi, M., Murata, J., Satake, H. (2014) "The Effect of Chitosan and Chitin Oligomers on Gene Expression and ... Koyama T, Sato F. (2018) "The function of ETHYLENE RESPONSE FACTOR genes in the light-induced anthocyanin production of ...
Resveratrol impairs cellular mechanisms associated with the pathogenesis of endometriosis
The effects of resveratrol on 12Z and St-T1b cell viability were assessed by MTT assay, apoptosis by FITC Annexin V assay and ... The effect of resveratrol on the expression of genes related to cell migration, angiogenesis and cell stemness was evaluated by ... 6 Department of Radiotherapy-Radiooncology, Münster University Hospital, Albert-Schweitzer-Campus 1, A1, Münster 48149, Germany ... Keywords: Endometrial cell primary culture; Endometriosis; Gene expression; Natural compounds; Resveratrol; Stem cells. ...
Human milk inhibits some enveloped virus infections, including SARS-CoV-2, in an intestinal model | Life Science Alliance
2021) Annexin a1 as a potential prognostic biomarker for covid-19 disease: Case-control study. Int J Clin Pract 75: e14606. doi ... 2,098 genes and 124 genes were differentially expressed in the SARS-CoV-2 only and mock conditions, respectively. Gene set ... 2015) Annexin a1-containing extracellular vesicles and polymeric nanoparticles promote epithelial wound repair. J Clin Invest ... Data information: In (D, E, F, G), each data point represents a gene. The log2fold change of each gene is represented in the x- ...