Loading...
*  Inactive serine/threonine-protein kinase/endoribonuclease elisa and antibody
Recombinant Protein and Inactive serine/threonine-protein kinase/endoribonuclease Antibody at MyBioSource. Custom ELISA Kit, ... Shop Inactive serine/threonine-protein kinase/endoribonuclease ELISA Kit, ... Inactive serine/threonine-protein kinase/endoribonuclease IRE1-like. Inactive serine/threonine-protein kinase/endoribonuclease ... Inactive serine/threonine-protein kinase/endoribonuclease. LOG IN MY ACCOUNT CART CONTENTS CHECKOUT ...
https://www.mybiosource.com/protein_family.php?root=inactive-serine-threonine-protein-kinase-endoribonuclease
*  Basis for regulated RNA cleavage by functional analysis of RNase L and Ire1p. - Walter Lab
RNase L and Ire1p are members of a superfamily of regulated endoribonucleases that play essential roles in mediating diverse ... a transmembrane serine/threonine kinase and endoribonuclease. To probe their similarities and differences, molecular properties ...
http://walterlab.ucsf.edu/publication/365/basis-for-regulated-rna-cleavage-by-functional-analysis-of-rnase-l-and-ire1p/
*  The crystal structure of the Escherichia coli RNase E apoprotein and a mechanism for RNA degradation. - Oxford Neuroscience
RNase E is an essential bacterial endoribonuclease involved in the turnover of messenger RNA and the maturation of structured ... RNase E is an essential bacterial endoribonuclease involved in the turnover of messenger RNA and the maturation of structured ... Amino Acid Sequence, Apoproteins, Crystallography, X-Ray, Endoribonucleases, Escherichia coli, Escherichia coli Proteins, ...
https://www.neuroscience.ox.ac.uk/publications/100742
*  Endoribonuclease - Wikipedia
Further examples include Endoribonuclease XendoU found in frogs (Xenopus). Endoribonucleases at the US National Library of ... An Endoribonuclease is a ribonuclease endonuclease. It cleaves either single-stranded or double-stranded RNA, depending on the ...
https://en.wikipedia.org/wiki/Endoribonuclease
*  Inducing circular RNA formation using the CRISPR endoribonuclease Csy4. | Sigma-Aldrich
The endoribonuclease activity and 3' end-stabilizing properties of Csy4 are particularly suited for this task. Coexpression of ... Inducing circular RNA formation using the CRISPR endoribonuclease Csy4.. [Erin K Borchardt, Rita M Meganck, Heather A Vincent, ... Here we describe a switch for inducing back-splicing of an engineered circRNA that relies on the CRISPR endoribonuclease, Csy4 ...
https://www.sigmaaldrich.com/catalog/papers/28223408
*  Endoribonuclease XendoU - Wikipedia
In molecular biology, Endoribonuclease XendoU refers to a protein domain. This particular entry represents endoribonucleases ... XendoU, is the endoribonuclease responsible for this activity. Studies have shown that XendoU-RNA complex is Manganese(Mn2+)- ... Renzi F, Caffarelli E, Laneve P, Bozzoni I, Brunori M, Vallone B (2006). "The structure of the endoribonuclease XendoU: From ... the endoribonuclease involved in small nucleolar RNA biosynthesis". J Biol Chem. 280 (19): 18996-9002. doi:10.1074/jbc. ...
https://en.wikipedia.org/wiki/Endoribonuclease_XendoU
*  RMRP (RNA component of mitochondrial RNA processing endoribonuclease)
RNA component of mitochondrial RNA processing endoribonuclease), Authors: Pia Hermanns, Kerstin Reicherter, Brendan Lee. ... Characterization of human MRP/Th RNA and its nuclear gene: full length MRP/Th RNA is an active endoribonuclease when assembled ... Homology RNase P is also a ribonucleoprotein endoribonuclease that is mainly involved in tRNA precursor maturation. RNase P and ... RMRP (RNA component of mitochondrial RNA processing endoribonuclease). Written. 2007-12. Pia Hermanns, Kerstin Reicherter, ...
http://atlasgeneticsoncology.org/Genes/GC_RMRP.html
*  DCL3B - Endoribonuclease Dicer homolog 3b - Oryza sativa subsp. japonica (Rice) - DCL3B gene & protein
Endoribonuclease Dicer homolog 3bAdd BLAST. 1637. Proteomic databases. PaxDb, a database of protein abundance averages across ... Endoribonuclease Dicer homolog 3b. Alternative name(s):. Dicer-like protein 3b (EC:3.1.26.-*Search proteins in UniProtKB for ... sp,Q7XD96,DCL3B_ORYSJ Endoribonuclease Dicer homolog 3b OS=Oryza sativa subsp. japonica OX=39947 GN=DCL3B PE=3 SV=2 ...
https://www.uniprot.org/uniprot/Q7XD96
*  PLOS Genetics: Global Regulatory Functions of the Staphylococcus aureus Endoribonuclease III in Gene Expression
The universally conserved double-strand-specific endoribonuclease III (RNase III) in S. aureus is known to repress the ... Global Regulatory Functions of the Staphylococcus aureus Endoribonuclease III in Gene Expression. Table 1. Validation of ...
https://journals.plos.org/plosgenetics/article/figure?id=10.1371/journal.pgen.1002782.t001
*  EAI 04066 - Endoribonuclease Dcr-1 - Harpegnathos saltator (Jerdon's jumping ant) - EAI 04066 gene & protein
Endoribonuclease Dcr-1Imported. ,p>Information which has been imported from another database using automatic procedures.,/p> ,p ... tr,E2C370,E2C370_HARSA Endoribonuclease Dcr-1 OS=Harpegnathos saltator OX=610380 GN=EAI_04066 PE=3 SV=1 ...
https://www.uniprot.org/uniprot/E2C370
*  Endoribonucleases For Rna Detection And Analysis - Available technology for licensing from the University of California,...
UC Berkeley researchers discovered variant Cas endoribonucleases, nucleic acids encoding the variant Cas endoribonucleases, and ... For example, it was found that the variant Cas endoribonuclease has an amino acid substitution at a histidine residue such that ... Endoribonucleases that process CRISPR transcripts are bacterial or archaeal enzymes capable of catalyzing sequence- and ... Endoribonucleases For Rna Detection And Analysis. Tech ID: 29125 / UC Case 2012-124-0 ...
https://techtransfer.universityofcalifornia.edu/NCD/29125.html?int_campaign=OnHoldTech_Inventors-Other-Tech-section
*  Identification of endoribonuclease specific cleavage positions reveals novel targets of RNase III in Streptococcus pyogenes
... Le ... which enables the identification of direct endoribonuclease targets in vivo by comparing the 5' and 3' ends of processed ...
http://umu.diva-portal.org/smash/record.jsf?pid=diva2:1093256
*  IRE1α Kinase Activation Modes Control Alternate Endoribonuclease Outputs to Determine Divergent Cell Fates
... Dan Han,1,3,4,6 ... We found that the ER transmembrane kinase/endoribonuclease (RNase) IRE1α is a key component of this apoptotic switch ER stress ... IRE1α is an ER transmembrane protein containing two enzymatic activities, a kinase and an endoribonuclease (RNase), both ... response pathway from the endoplasmic reticulum to the nucleus requires a novel bifunctional protein kinase/endoribonuclease ( ...
http://pubmedcentralcanada.ca/pmcc/articles/PMC2762408/?lang=en-ca
*  Rae1/YacP, a new endoribonuclease involved in ribosome-dependent mRNA decay in Bacillus subtilis - Infoscience
Multiple lines of evidence converge to suggest that Rae1 is an A-site endoribonuclease. We present a docking model of Rae1 ... Rae1/YacP, a new endoribonuclease involved in ribosome-dependent mRNA decay in Bacillus subtilis Leroy, Magali ; Piton, Jeremie ... Multiple lines of evidence converge to suggest that Rae1 is an A-site endoribonuclease. We present a docking model of Rae1 ... Home , Rae1/YacP, a new endoribonuclease involved in ribosome-dependent mRNA decay in Bacillus subtilis ...
https://infoscience.epfl.ch/record/228665
*  Rae1/YacP, a new endoribonuclease involved in ribosome‐dependent mRNA decay in Bacillus subtilis | The EMBO Journal
Prysak MH, Mozdzierz CJ, Cook AM, Zhu L, Zhang Y, Inouye M, Woychik NA (2009) Bacterial toxin YafQ is an endoribonuclease that ... Rae1/YacP, a new endoribonuclease involved in ribosome‐dependent mRNA decay in Bacillus subtilis. Magali Leroy, Jérémie Piton, ... A new bacterial endoribonuclease Rae1/YacP, founding member of the NYN subfamily of PIN domain proteins, cleaves mRNAs at ... Multiple lines of evidence converge to suggest that Rae1 is an A‐site endoribonuclease. We present a docking model of Rae1 ...
http://emboj.embopress.org/content/36/9/1167
*  Ire1p: a kinase and site-specific endoribonuclease. - Walter Lab
Ire1p: a kinase and site-specific endoribonuclease.. Walter P. Ire1p: a kinase and site-specific endoribonuclease. Methods Mol ...
http://walterlab.ucsf.edu/publication/370/ire1p-a-kinase-and-site-specific-endoribonuclease/
*  Endoribonuclease LACTB2
Endoribonuclease; cleaves preferentially 3' to purine-pyrimidine dinucleotide motifs in single-stranded RNA. The cleavage ...
https://pharos.nih.gov/idg/targets/Q53H82
*  Serine/threonine-protein kinase/endoribonuclease IRE2
MASAVRGSRPWPRLGLQLQFAALLLGTLSPQVHTLRPENLLLVSTLDGSLHALSKQTGDLKWTLRDDPVI 1 - 70 EGPMYVTEMAFLSDPADGSLYILGTQKQQGLMKLPFTIPELVHASPCRSSDGVFYTGRKQDAWFVVDPES 71 - 140 GETQMTLTTEGPSTPRLYIGRTQYTVTMHDPRAPALRWNTTYRRYSAPPMDGSPGKYMSHLASCGMGLLL 141 - 210 TVDPGSGTVLWTQDLGVPVMGVYTWHQDGLRQLPHLTLARDTLHFLALRWGHIRLPASGPRDTATLFSTL 211 - 280 DTQLLMTLYVGKDETGFYVSKALVHTGVALVPRGLTLAPADGPTTDEVTLQVSGEREGSPSTAVRYPSGS 281 - 350 VALPSQWLLIGHHELPPVLHTTMLRVHPTLGSGTAETRPPENTQAPAFFLELLSLSREKLWDSELHPEEK 351 - 420 TPDSYLGLGPQDLLAASLTAVLLGGWILFVMRQQQPQVVEKQQETPLAPADFAHISQDAQSLHSGASRRS 421 - 490 QKRLQSPSKQAQPLDDPEAEQLTVVGKISFNPKDVLGRGAGGTFVFRGQFEGRAVAVKRLLRECFGLVRR 491 - 560 EVQLLQESDRHPNVLRYFCTERGPQFHYIALELCRASLQEYVENPDLDRGGLEPEVVLQQLMSGLAHLHS 561 - 630 LHIVHRDLKPGNILITGPDSQGLGRVVLSDFGLCKKLPAGRCSFSLHSGIPGTEGWMAPELLQLLPPDSP 631 - 700 TSAVDIFSAGCVFYYVLSGGSHPFGDSLYRQANILTGAPCLAHLEEEVHDKVVARDLVGAMLSPLPQPRP 701 - 770 SAPQVLAHPFFWSRAKQLQFFQDVSDWLEKESEQEPLVRALEAGGCAVVRDNWHEHISMPLQTDLRKFRS 771 - 840 ...
https://pharos.nih.gov/idg/targets/ERN2
*  Genetic and biochemical analysis of the endoribonuclease E/G family in RNA metabolism in Escherichia coli K-12
... ... In Escherichia coli, the RNase E/G endoribonuclease family plays a central role in the initiation of both processes. This ...
https://athenaeum.libs.uga.edu/handle/10724/24860
*  Multiple autophosphorylations significantly enhance the endoribonuclease activity of human inositol requiring enzyme 1α | BMC...
Tirasophon W, Lee K, Callaghan B, Welihinda A, Kaufman RJ: The endoribonuclease activity of mammalian IRE1 autoregulates its ... Multiple autophosphorylations significantly enhance the endoribonuclease activity of human inositol requiring enzyme 1α. ... Divergent allosteric control of the IRE1alpha endoribonuclease using kinase inhibitors. Nat Chem Biol. 2012, 8 (12): 982-989. ... Potent and selective inhibitors of the inositol-requiring enzyme 1 endoribonuclease. J Biol Chem. 2011, 286 (14): 12743-12755. ...
https://bmcbiochem.biomedcentral.com/articles/10.1186/1471-2091-15-3
*  Localization of 3'-nucleotidase and calcium-dependent endoribonuclease in the plasma-membrane of Trypanosoma brucei. | DIAL...
Localization of 3'-nucleotidase and calcium-dependent endoribonuclease in the plasma-membrane of Trypanosoma brucei.. In: Acta ... Alkaline 3'-endoribonuclease is also located in the plasma membrane of T. brucei and this activity shares a great number of ... Localization of 3'-nucleotidase and calcium-dependent endoribonuclease in the plasma-membrane of Trypanosoma brucei. Primary ... Animals ; Cell Membrane - enzymology ; Endoribonucleases - metabolism ; Nucleotidases - metabolism ; Trypanosoma brucei brucei ...
https://dial.uclouvain.be/pr/boreal/object/boreal:27042
*  "The HIV-1 Protein Vpr Targets the Endoribonuclease Dicer for Proteasom" by Laurieann Klockow, Hamayun J. Sharifi et al.
Here we identify the endoribonuclease Dicer as a target of HIV-1 Vpr-directed proteasomal degradation through CRL4DCAF1. We ... Here we identify the endoribonuclease Dicer as a target of HIV-1 Vpr-directed proteasomal degradation through CRL4DCAF1. We ... The HIV-1 Protein Vpr Targets the Endoribonuclease Dicer for Proteasomal Degradation to Boost Macrophage Infection ...
https://epublications.marquette.edu/biomedsci_fac/32/