Loading...
*  Disintegrin - Wikipedia
Disintegrins are split into 5 classes: small, medium, large, dimeric, and snake venom metalloproteinases. Small Disintegrins: ... 49-51 amino acids, 4 disulfide bonds Medium Disintegrins: 70 amino acids, 6 disulfide bonds Large Disintegrins: 84 amino acids ... Disintegrins contain an RGD (Arg-Gly-Asp) or KGD (Lys-Gly-Asp) sequence motif that binds specifically to integrin IIb-IIIa ... Disintegrins are a family of small proteins (45-84 amino acids in length) from viper venoms that function as potent inhibitors ...
https://en.wikipedia.org/wiki/Disintegrin
*  DISINTEGRIN 2 (PS50214) | InterPro | EMBL-EBI
DISINTEGRIN_2 (PS50214). Accession PS50214 Integration. Disintegrin domain (IPR001762) Member database. PROSITE patterns. ...
http://www.ebi.ac.uk/interpro/signature/PS50214
*  A family of cellular proteins related to snake venom disintegrins | PNAS
Disintegrins are short soluble integrin ligands that were initially identified in snake venom. A previously recognized cellular ... A family of cellular proteins related to snake venom disintegrins. G Weskamp and C P Blobel ... Evidently, cellular proteins containing a disintegrin domain define a superfamily of potential integrin ligands that are likely ... Here we present peptide sequences that are characteristic for several cellular disintegrin-domain proteins. These peptide ...
https://www.pnas.org/content/91/7/2748?ijkey=6729e12edb06c79fa50c44c6171f1c939c7f0ed3&keytype2=tf_ipsecsha
*  Disintegrin lutosin - Crotalus oreganus lutosus (Great basin rattlesnake)
IPR018358 Disintegrin_CS. IPR001762 Disintegrin_dom. IPR036436 Disintegrin_dom_sf. Pfami. View protein in Pfam. PF00200 ... Disintegrin lutosinAdd BLAST. 73. Amino acid modifications. Feature key. Position(s). DescriptionActions. Graphical view. ... The disintegrin belongs to the medium disintegrin subfamily.. ,p>The ,a href="http://www.geneontology.org/">Gene Ontology (GO ... sp,P31986,VM2I_CROOL Disintegrin lutosin OS=Crotalus oreganus lutosus OX=332626 PE=1 SV=1 ...
https://www.uniprot.org/uniprot/P31986
*  Disintegrin and metalloproteinase domain-containing protein 22 (Q9P0K1) | InterPro | EMBL-EBI
InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites. We combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful integrated database and diagnostic tool.
http://www.ebi.ac.uk/interpro/protein/Q9P0K1
*  Zinc metalloproteinase-disintegrin-like HF3 precursor - Bothrops jararaca (Jararaca)
The metalloproteinase-disintegrin-like HF3 is a potent hemorrhagic toxin that activates macrophages for phagocytosis through ... IPR018358 Disintegrin_CS. IPR001762 Disintegrin_dom. IPR036436 Disintegrin_dom_sf. IPR024079 MetalloPept_cat_dom_sf. IPR001590 ... IPR018358 Disintegrin_CS. IPR001762 Disintegrin_dom. IPR036436 Disintegrin_dom_sf. IPR024079 MetalloPept_cat_dom_sf. IPR001590 ... The disintegrin domain belongs to the long disintegrin subfamily.. ,p>This subsection of the 'Function' section provides ...
https://www.uniprot.org/uniprot/Q98UF9
*  Disintegrins: integrin selective ligands which activate integrin-coupled signaling and modulate leukocyte functions. - PubMed ...
Disintegrins are a family of low-molecular weight, cysteine-rich peptides first identified in snake venom, usually containing ... Disintegrins have proven useful as tools to improve the understanding of the molecular events regulated by integrin signaling ... Disintegrins: integrin selective ligands which activate integrin-coupled signaling and modulate leukocyte functions.. Barja- ... In this review we show that, depending on the cell type and the microenvironment, disintegrins are able to antagonize the ...
https://www.ncbi.nlm.nih.gov/pubmed/16172744?dopt=Abstract
*  a disintegrin and metallopeptidase domain 2 ELISA Kits | Biocompare.com
Compare a disintegrin and metallopeptidase domain 2 ELISA Kits from leading suppliers on Biocompare. View specifications, ... a disintegrin and metallopeptidase domain 2 ELISA Kits. The ELISA (enzyme-linked immunosorbent assay) is a well-established ... Guinea Pig Disintegrin and metalloproteinase domain-containing protein 2, ADAM2 ELISA Kit ... Your search returned 25 a disintegrin and metallopeptidase domain 2 ELISA ELISA Kit across 4 suppliers. ...
https://www.biocompare.com/pfu/110627/soids/2-1036417/ELISA_Kit/ELISA_a_disintegrin_and_metallopeptidase_domain_2
*  a disintegrin and metallopeptidase domain 15 (metargidin) ELISA Kits | Biocompare.com
Compare a disintegrin and metallopeptidase domain 15 (metargidin) ELISA Kits from leading suppliers on Biocompare. View ... a disintegrin and metallopeptidase domain 15 (metargidin) ELISA Kits. The ELISA (enzyme-linked immunosorbent assay) is a well- ... Your search returned 29 a disintegrin and metallopeptidase domain 15 (metargidin) ELISA ELISA Kit across 7 suppliers. ...
https://www.biocompare.com/pfu/110627/soids/2-600773/ELISA_Kit/ELISA_a_disintegrin_and_metallopeptidase_domain_15_metargidin
*  Toxins | Free Full-Text | Lebein, a Snake Venom Disintegrin, Induces Apoptosis in Human Melanoma Cells
Anti-neoplasic properties have been highlighted for different disintegrins from snake venom including Lebein; however, the ... Keywords: Lebein; disintegrin; snake venom; Macrovipera lebetina; melanoma; apoptosis Lebein; disintegrin; snake venom; ... Lebein, a Snake Venom Disintegrin, Induces Apoptosis in Human Melanoma Cells. Manel B. Hammouda 1,2,3. ... Anti-neoplasic properties have been highlighted for different disintegrins from snake venom including Lebein; however, the ...
http://www.mdpi.com/2072-6651/8/7/206
*  KUZ, a Conserved Metalloprotease-Disintegrin Protein with Two Roles in Drosophila Neurogenesis | Science
The kuz gene encodes a metalloprotease-disintegrin protein with a highly conserved bovine homolog, raising the possibility that ... KUZ, a Conserved Metalloprotease-Disintegrin Protein with Two Roles in Drosophila Neurogenesis ... KUZ, a Conserved Metalloprotease-Disintegrin Protein with Two Roles in Drosophila Neurogenesis ... KUZ, a Conserved Metalloprotease-Disintegrin Protein with Two Roles in Drosophila Neurogenesis ...
https://science.sciencemag.org/content/273/5279/1227?ijkey=8d867ee6de26996077d9e4fdcfe3a5acac1388f8&keytype2=tf_ipsecsha
*  DIGITAL.CSIC: Snake venom disintegrins: novel dimeric disintegrins and structural diversification by disulphide bond engineering
Snake venom disintegrins: novel dimeric disintegrins and structural diversification by disulphide bond engineering. ... Comparison of the amino acid sequences of the dimeric disintegrins with those of other disintegrins by multiple-sequence ... supports the view that the different disintegrin subfamilies evolved from a common ADAM (a disintegrin and metalloproteinase- ... A second group of dimeric disintegrins (VLO5 and EO5) had MLD and VGD motifs in their subunits and blocked the adhesion of the ...
https://digital.csic.es/handle/10261/3631
*  Human Metabolome Database: Showing Protein A disintegrin and metalloproteinase with thrombospondin motifs 1 (HMDBP07253)
Showing Protein A disintegrin and metalloproteinase with thrombospondin motifs 1 (HMDBP07253). IdentificationBiological ... A disintegrin and metalloproteinase with thrombospondin motifs 1 MQRAVPEGFGRRKLGSDMGNAERAPGSRSFGPVPTLLLLAAALLAVSDALGRPSEEDEEL ...
http://www.hmdb.ca/proteins/HMDBP07253
*  miR-221-3p inhibits oxidized low-density lipoprotein induced oxidative stress and apoptosis via targeting a disintegrin and...
A disintegrin and metalloprotease-22 (ADAM22) is predicted as a direct target of miR-221-3p, and silencing AMAM22 resulted in a ... a disintegrin and metalloprotease-22 (ADAM22); apoptosis; miR-221-3p; oxidative stress; oxidized low-density lipoprotein (Ox- ... miR-221-3p inhibits oxidized low-density lipoprotein induced oxidative stress and apoptosis via targeting a disintegrin and ...
https://www.ncbi.nlm.nih.gov/pubmed/?cmd=Search&term=Ruoshui%20Li
*  A Disintegrin and Metalloproteinase 9 Is Involved in Ectodomain Shedding of Receptor-Binding Cancer Antigen Expressed on SiSo...
A disintegrin and metalloproteinase (ADAM) 9 was shown to be involved in the ectodomain shedding of RCAS1. Given the ... A Disintegrin and Metalloproteinase 9 Is Involved in Ectodomain Shedding of Receptor-Binding Cancer Antigen Expressed on SiSo ...
https://www.hindawi.com/journals/bmri/2014/482396/abs/
*  ADAMTS4 Antibody (Disintegrin-like Domain, PE) for IHC IHC-plus™ LS-A107152
ADAMTS4 Antibody (Disintegrin‑like Domain) IHC‑plus™ LS‑A7773 Species: Human, Monkey, Mouse, Bat, Bovine, Dog, Guinea pig, ... ADAMTS4 antibody was raised against synthetic 15 amino acid peptide from Disintegrin-like domain of human ADAMTS4. Percent ...
https://www.lsbio.com/antibodies/adamts4-antibody-disintegrin-like-domain-pe-ihc-ihc-plus-ls-a107152/704881
*  Zinc metalloproteinase-disintegrin-like halysase elisa and antibody
Recombinant Protein and Zinc metalloproteinase-disintegrin-like halysase Antibody at MyBioSource. Custom ELISA Kit, Recombinant ... Shop Zinc metalloproteinase-disintegrin-like halysase ELISA Kit, ... Zinc metalloproteinase-disintegrin-like halysase. LOG IN MY ... Zinc metalloproteinase-disintegrin-like halysase. Zinc metalloproteinase-disintegrin-like halysase ELISA Kit. Zinc ... Zinc metalloproteinase-disintegrin-like halysase Antibody. Also known as Zinc metalloproteinase-disintegrin-like halysase ( ...
https://www.mybiosource.com/protein_family.php?root=zinc-metalloproteinase-disintegrin-like-halysase
*  Zinc metalloproteinase-disintegrin-like kaouthiagin elisa and antibody
Recombinant Protein and Zinc metalloproteinase-disintegrin-like kaouthiagin Antibody at MyBioSource. Custom ELISA Kit, ... Shop Zinc metalloproteinase-disintegrin-like kaouthiagin ELISA Kit, ... Zinc metalloproteinase-disintegrin-like kaouthiagin-like. Zinc metalloproteinase-disintegrin-like kaouthiagin-like ELISA Kit. ... Zinc metalloproteinase-disintegrin-like kaouthiagin-like Antibody. Also known as Zinc metalloproteinase-disintegrin-like ...
https://www.mybiosource.com/protein_family.php?root=zinc-metalloproteinase-disintegrin-like-kaouthiagin
*  A Disintegrin And Metalloproteinase Domain 18 | definition of A Disintegrin And Metalloproteinase Domain 18 by Medical...
What is A Disintegrin And Metalloproteinase Domain 18? Meaning of A Disintegrin And Metalloproteinase Domain 18 medical term. ... What does A Disintegrin And Metalloproteinase Domain 18 mean? ... Looking for online definition of A Disintegrin And ... Metalloproteinase Domain 18 in the Medical Dictionary? A Disintegrin And Metalloproteinase Domain 18 explanation free. ... A Disintegrin and Metalloprotease with Thrombospondin Motifs 14. *A Disintegrin and Metalloprotease with Thrombospondin Motifs ...
http://medical-dictionary.thefreedictionary.com/A+Disintegrin+And+Metalloproteinase+Domain+18
*  A Disintegrin And Metalloprotease Domain 32 | definition of A Disintegrin And Metalloprotease Domain 32 by Medical dictionary
What is A Disintegrin And Metalloprotease Domain 32? Meaning of A Disintegrin And Metalloprotease Domain 32 medical term. What ... Looking for online definition of A Disintegrin And Metalloprotease Domain 32 in the Medical Dictionary? A Disintegrin And ... A Disintegrin And Metalloprotease Domain 32 , definition of A Disintegrin And Metalloprotease Domain 32 by Medical dictionary ... A Disintegrin and Metalloprotease with Thrombospondin Motifs 14. *A Disintegrin and Metalloprotease with Thrombospondin Motifs ...
http://medical-dictionary.thefreedictionary.com/A+Disintegrin+And+Metalloprotease+Domain+32
*  Trimucrin, an Arg-Gly-Asp containing disintegrin, attenuates myocardial ischemia-reperfusion injury in murine by inhibiting...
Trimucrin, an Arg-Gly-Asp containing disintegrin, attenuates myocardial ischemia-reperfusion injury in murine by inhibiting ... Trimucrin, a novel small-mass Arg-Gly-Asp (RGD)-containing disintegrin, has been demonstrated to possess anti-platelet and anti ...
https://insights.ovid.com/eujoph/201710150/00003656-201710150-00004
*  Role of ADAMTS (A Disintegrin and Metalloproteinase With Thrombospondin Motifs)-5 in Aortic Dilatation and Extracellular Matrix...
Role of ADAMTS (A Disintegrin and Metalloproteinase With Thrombospondin Motifs)-5 in Aortic Dilatation and Extracellular Matrix ... Role of ADAMTS (A Disintegrin and Metalloproteinase With Thrombospondin Motifs)-5 in Aortic Dilatation and Extracellular Matrix ... Role of ADAMTS (A Disintegrin and Metalloproteinase With Thrombospondin Motifs)-5 in Aortic Dilatation and Extracellular Matrix ... Role of ADAMTS (A Disintegrin and Metalloproteinase With Thrombospondin Motifs)-5 in Aortic Dilatation and Extracellular Matrix ...
http://atvb.ahajournals.org/content/early/2018/04/04/ATVBAHA.117.310562